KEGG   Brassica oleracea (wild cabbage): 106315193Help
Entry
106315193         CDS       T04124                                 

Definition
(RefSeq) short-chain type dehydrogenase/reductase
  KO
K00059  3-oxoacyl-[acyl-carrier protein] reductase [EC:1.1.1.100]
Organism
boe  Brassica oleracea (wild cabbage)
Pathway
boe00061  Fatty acid biosynthesis
boe00780  Biotin metabolism
boe01100  Metabolic pathways
boe01212  Fatty acid metabolism
Module
boe_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:boe00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    106315193
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    106315193
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    106315193
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:boe01004]
    106315193
Enzymes [BR:boe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.100  3-oxoacyl-[acyl-carrier-protein] reductase
     106315193
Lipid biosynthesis proteins [BR:boe01004]
 Fatty acid synthase
  Component type
   106315193
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase
Motif
Other DBs
NCBI-GeneID: 106315193
NCBI-ProteinID: XP_013608396
UniProt: A0A0D3EEI5
LinkDB All DBs
Position
C9
AA seq 265 aa AA seqDB search
MAVPFYPPYSLAGRVAIVTGSSRGIGRAIAIHLAELGAKVLINYTTRSTDADQVAAEINS
SAGANGPEPVAFVFRADISDSSQVESLFDAAEKAFNSQVHILVNSAGIVDPNYPTIANTP
IEDFDRIFRVNTRGSFLCCKEAAKRLKRGGGGRIILLTSSLTEALIPGQGAYTASKAAVE
TMAKILAKELKGSGIAANCVSPGPVATEMFFSGKSEETVRSIIERSPFGRLGETRDIAPV
VGFLASDGGEWINGQVIVANGAFLK
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atggctgtacctttttatccgccgtactccctcgccggccgagtcgcgatagtcaccggt
tcatctcgtggaattggccgagccatagctatacacctcgccgagctcggcgcaaaggta
ctcatcaactacaccaccagatccactgacgccgatcaagtcgccgctgaaatcaactca
tccgccggtgctaatggtccggaaccggtagcattcgtcttccgcgccgatatctcggac
tcaagccaggtagagtctctcttcgacgcggcggagaaagccttcaactcgcaggttcac
atcctggttaactcagctgggatcgtcgatcccaactaccccaccatcgccaacactccc
attgaggatttcgatcgcatcttcagggtgaacacgagaggatcattcttgtgctgtaaa
gaagctgccaagaggctaaaacgtggaggcggtggtcggatcatactcctaacttcctcc
ttaaccgaggcgctaatcccgggacaaggagcttacacagcatcaaaagcagccgttgaa
acaatggcgaagattctcgccaaggaactcaaaggctcagggatcgctgcaaactgtgtt
tctccaggtcctgtcgccactgagatgttcttcagtgggaagagcgaggagacagtgcgg
agtatcattgaaaggagtccttttggtagacttggtgagaccagagacattgctcctgtc
gttggtttcttagctagtgatggtggtgagtggatcaatggccaagtcattgtagctaac
ggtgcattccttaaatga

DBGET integrated database retrieval system