KEGG   Brassica oleracea (wild cabbage): 106317914Help
Entry
106317914         CDS       T04124                                 

Definition
(RefSeq) cationic amino acid transporter 9, chloroplastic
  KO
K03294  basic amino acid/polyamine antiporter, APA family
Organism
boe  Brassica oleracea (wild cabbage)
Brite
KEGG Orthology (KO) [BR:boe00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    106317914
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AA_permease_2 AA_permease AA_permease_C Spore_permease
Motif
Other DBs
NCBI-GeneID: 106317914
NCBI-ProteinID: XP_013611179
UniProt: A0A0D3DZJ4
LinkDB All DBs
Position
C9
AA seq 570 aa AA seqDB search
MGGHQGSSTERFSSATWFSQLCTSARRFKSLAPPSLETAVRSTSGDSLVRRLGLCDLILL
GIGASIGAGVFVVTGTVARDAGPGVTISFLLAGASCVLNALCYAELASRFPAVVGGAYMY
SYSAFNEITAFLVFVQLMLDYHIGAASISRSLASYAVALLELFPAFKGCIPLWIGSGQEL
FGGFLSFNILAPILLALLTLVLCQGVRESSAVNSVMTATKVVIVLVVICAGAFDIDVANW
SPFAPNGFKAVLTGATVVFFSYVGFDAVANSAEESNNPQRDLPIGIMGSLLVCISLYIGV
CLVLTGMVPFNLLSEDAPLAEAFSSKGMKFVSVLISIGAVAGLTTTLLVGLYVQSRLYLG
LGRDGLLPSFFSRIHPTLHTPLHSQIWCGIVAAVLAGIFNVHSLSHILSVGTLTGYSVVA
ACVVALRLNDKKERESSNRWTSSWHEGVICLVIIACSGFGAGVFYRFSASVIFLLLSVGV
AVSASAVLHYRRAYAQSLGSGFCCPGVPIVPCVCIFFNIFLFAQLHYEAWIRFVVVSVLA
TAVYALYGQYHADASTLIYQRAPESESDSG
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
atgggaggccaccaaggttccagcacagaacgcttctcctccgccacatggttctcccag
ttgtgtacttcagctcgccgatttaaatcattggctcctccgtccttggagactgccgtt
cgctccacctccggcgactctttagttcgtcgcctcggcctctgcgacctcatactgttg
ggtatcggcgcttccatcggcgccggcgtcttcgtagttacgggaaccgtcgctcgcgat
gctggacccggagtgacgatcagcttcttgctagcgggagcatcgtgcgtgttgaacgct
ctctgttacgcagaacttgcatctcgtttccctgctgttgttgggggagcttacatgtac
tcgtattcagctttcaacgagatcaccgcttttctcgttttcgttcagctcatgcttgac
tatcatattggggcggctagtatctctcgtagcttggcaagctatgcggttgcgctgctt
gagctttttccagctttcaagggctgtattcctctctggattggaagcggccaagagttg
ttcggaggctttctctctttcaatattttggctcccattttacttgcgctcctcaccctt
gttctatgccagggtgtgcgagaatcttccgctgtaaactccgtcatgactgctaccaag
gtcgttatcgttctcgttgttatttgtgccggagcttttgatattgatgtagcaaattgg
tcccctttcgcccctaatggttttaaagctgtactcactggagctactgtagtcttcttt
tcttatgttggatttgacgctgttgctaattctgctgaagaatccaacaaccctcagcgc
gacctcccaatcggaattatggggagccttcttgtatgtatctccttgtatattggagtc
tgtttagtgctcactgggatggtcccttttaatctcctcagcgaagatgctcctttagcc
gaagccttttcatcaaagggtatgaagttcgtctcagtcttaatcagtattggtgctgtt
gctggactcacaactactctgcttgttggtctttatgttcagtccaggttgtatctgggg
ctaggaagggatggtctgttgccctcattcttttccagaatacacccaactcttcataca
cctcttcattctcaaatctggtgtggcattgttgctgctgttttagctggcatctttaat
gtgcatagcctttctcatattctgtcagttggtacattgactgggtattcagtcgttgca
gcttgtgttgtagctttgagattgaacgataagaaagaaagggagtcgtccaatcgatgg
acatcaagttggcatgaaggcgtcatttgccttgttataattgcatgcagtggttttggt
gctggcgtattttaccgttttagtgcttcagttatatttcttcttctctcagtaggtgtg
gcagttagtgcttcagcagttctccattatcgtcgagcttatgctcagtctcttggttcg
gggttttgctgtcctggtgtgcccattgtgccatgcgtctgcattttctttaacatcttc
ttatttgcgcagttgcattatgaagcatggataagatttgttgttgtgagtgtgcttgca
actgcggtttatgccttgtatggacagtaccatgccgatgcaagcaccttgatttatcag
agggcacctgaaagtgaaagtgactctgggtaa

DBGET integrated database retrieval system