KEGG   Brassica oleracea (wild cabbage): 106318576Help
Entry
106318576         CDS       T04124                                 

Definition
(RefSeq) sorbitol dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
boe  Brassica oleracea (wild cabbage)
Pathway
boe00040  Pentose and glucuronate interconversions
boe00051  Fructose and mannose metabolism
boe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:boe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    106318576
   00051 Fructose and mannose metabolism
    106318576
Enzymes [BR:boe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     106318576
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 PALP UDPG_MGDP_dh_N Pyr_redox_2 AlaDh_PNT_C Methyltransf_25 TrkA_N ThiF Pyr_redox_3
Motif
Other DBs
NCBI-GeneID: 106318576
NCBI-ProteinID: XP_013612062
LinkDB All DBs
Position
C9
AA seq 364 aa AA seqDB search
MGKGGMSQGEGSKVEEENMAAWLVGLNTLKIQPFPLPTLGPHDVRVRMKAVGICGSDVHY
LKTMRCADFIVKEPMVIGHECAGIIEEVGEGVKHLVVGDRVALEPGISCWRCNLCKEGRY
NLCPEMKFFATPPVHGSLANQVVHPADLCFKLPENVSLEEGAMCEPLSVGVHACRRAEVG
PETNVLVMGAGPIGLVTMLAARAFGVPKIVIVDVDDNRLSVAKRLGADGIVKVTTSLEDV
GSEVEQIKKAIGSNIDVTFDCAGFNKTMSTALAATRCGGKVCLVGMGHGIMTVPLTPAAA
REVDVVGVFRYKNTWPLCLEFLTSGKIDVKPLITHRFGFSQKEVEDAFETSARGSNAIKV
MFNL
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaaggaggaatgtctcagggagaaggctcaaaggtggaagaagagaacatggct
gcttggttggttggtctcaacactctcaagatccaaccttttcctcttcctacccttggt
cctcatgatgtgagagttaggatgaaggctgttggaatttgtggaagtgatgttcattac
ctcaagaccatgagatgtgcggatttcattgtgaaagaaccgatggtgattggacatgaa
tgtgccgggatcattgaagaggtaggtgaaggagtgaaacatctagtggtcggtgaccga
gtggctcttgaacctgggattagctgctggagatgcaacctctgcaaggaaggaagatac
aatctttgtcctgagatgaagttctttgcaaccccaccggttcatggctctctagctaac
caagtggttcaccctgcggatctgtgcttcaaactgcctgagaatgtgagtctggaggaa
ggagcaatgtgtgagccactaagtgttggtgtgcatgcttgtcgccgagcggaggttggt
cctgagacaaacgtgttggtaatgggagccggacctattggacttgtcaccatgttggct
gctcgtgcttttggtgtgccaaagattgtcattgtggatgttgatgataaccgtttatcc
gtagccaaacggctaggcgcagatgggattgttaaagtgacaacaagcttagaggatgtt
ggttctgaggttgaacaaattaagaaagctattgggtcaaacatcgatgtgacatttgat
tgtgcgggtttcaacaaaaccatgtcgacagcattagcagccactcgatgtggcggtaaa
gtctgccttgtcggaatgggtcacggtataatgactgtccctctcactcctgcagctgca
agggaggtagatgtggtgggtgtgttcaggtacaagaacacatggcctttatgtctcgag
ttccttacaagtggtaagattgatgtgaagccactcataacccacagatttggtttctct
cagaaggaagtggaagatgcctttgaaaccagtgctcgtggaagcaatgctattaaagtt
atgttcaatctctga

DBGET integrated database retrieval system