KEGG   Brassica oleracea (wild cabbage): 106318934Help
Entry
106318934         CDS       T04124                                 

Definition
(RefSeq) DNA ligase 4
  KO
K10777  DNA ligase 4 [EC:6.5.1.1]
Organism
boe  Brassica oleracea (wild cabbage)
Pathway
boe03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:boe00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    106318934
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:boe03400]
    106318934
Enzymes [BR:boe01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     106318934
DNA repair and recombination proteins [BR:boe03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    DNA Ligase 4 complex
     106318934
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N BRCT_2 DNA_ligase_A_C BRCT PTCB-BRCT DNA_ligase_IV
Motif
Other DBs
NCBI-GeneID: 106318934
NCBI-ProteinID: XP_013612558
LinkDB All DBs
Position
C9
AA seq 1203 aa AA seqDB search
MTEEIKLSVLVSLFNWIQKSKTSSQKRSKFRKFLDTYCKPSDYFAAVRLIIPSLDRERGS
YGLKESVLATCLIDALGISRDAPDAVRLLNWRKGGTAKAGANAGNFSLIAAEVLQRRQGM
ASGGLSVKELNDLLDRLASSENRGEKTSVLSTLIQKTNAQEMKWVIRIILKDLKLGMSER
SIFQEFHPDAEDLFNVTCDLKLVCEKLRDRHQRHKRQDIEVGKAVRPQLAMRISDVNAAW
KKLHGKDVVAECKFDGDRIQIHKNGTEIHYFSRNFLDHSEYAHAMSDLIVQNIMADRCIL
DGEMLVWDTSLNRFAEFGSNQEIAKAAREGLDSHRQLCYVAFDVLYVGDTSVIHQSLTER
HGLLRKVVKPLKGRLEVLVPEGGLNVHRPSGEPSWSIVVHSAADVERFFKETVENRDEGV
VLKDLGSKWEPGDRSGKWLKLKPEYVRAGSDLDVLIIGGYYGSGRHGGEVAQFLVGLADR
AEANVYPRRFMSFCRVGTGLSDEELNTVVSKLKPYFRKNEHPKKAPPSFYQVTNHSKERP
DVWIESPEKSIILSITSDIRTIRSEVFVAPYSLRFPRIDKVRYDKPWHECLDVQAFVELV
NSSNGTTQKQKESESMQDNPKVIKSSKRGGEKKNASLVPSQFIQTDVSDIKGKTSIFSNM
IFYFVNLPRSHSLDTFHKMVVENGGKFSMNLNNSVTHCIAAESSGIKYQAAKRQRDVIHF
SWVLDCCSRNILLPLQPKYFLHLTDASRTKLQDEIDEFSDSYFFDLDLEGLKQVLSNAKQ
SEDSKSIEYYKKKLCPEKRWSCFIGCCIYFHLYCETLSIEEEALLGIMAKRLALEVLMGG
GKVSHNLSHASHLVVLSTAEETLDFTSVSKSFSEKEKRLLLKRRLHVVNSNWLEDSLQRE
QKLSEDVYTLRPKSMEESDTEESDKSEHDTTEVASGVSAQTEEPASSKMAVTSSRGRSST
RAGNKRGRSSTNSVKRVQRRRGKQPSKIGGSETEESDTASEEKASTRLSDDIAEETGDTQ
RNSRRGRSAKRGKSRVAQPQRVQRSRRGNKPLKIGGDESEENDDFDDKKNDSAEEENKEE
TGEPDKAKQRDNTVTVEEASSKDSRNAKTEIDREEKIQIHEDPLQAMLMNMIPSLSLRNT
SRTTGDASTANVCGESESSERRKLGAETDNTCVMNAEAGEVPPPVKKKKVSYRDVAGELL
KDW
NT seq 3612 nt NT seq  +upstreamnt  +downstreamnt
atgacggaggagatcaaattaagcgtactagtgtctctgttcaactggattcagaagagc
aaaacctcatcccagaaacgctccaagttccgcaagttcctcgacacctactgcaaaccc
tccgattacttcgccgccgtccgtctcatcatcccgtcgctcgaccgagagcgaggcagc
tacggtctcaaggagtctgtgctcgccacgtgtctcatcgacgccctcggaatctctcgc
gatgctcccgacgcggttcgccttctcaattggcgcaaaggaggaaccgctaaggctgga
gccaacgccggaaacttctctttgattgctgctgaggtactgcaacgtaggcaagggatg
gcgtcgggtgggttgagtgttaaggagttgaatgatttgcttgatcgtttggcttcgagt
gagaacagaggggagaagacttctgttctttctacgctgattcagaagacgaatgcacag
gagatgaagtgggtcattaggatcattcttaaagatttgaagctggggatgagcgagagg
agcatatttcaggagttccatccagatgctgaggacttgtttaatgtcacttgtgacttg
aaactagtctgtgaaaagctcagggatcgccaccaacgtcacaagcgccaggatatagaa
gttggaaaagctgtacgaccccagttagctatgcgtatcagtgacgtgaatgctgcttgg
aagaagctccacgggaaagatgtagttgctgagtgcaaatttgatggggatcgcattcag
atacacaaaaatgggactgagatacattacttctctaggaacttccttgaccattctgaa
tatgcacatgccatgtcggatcttatcgtacaaaatataatggctgacaggtgtatcctt
gatggtgaaatgttggtttgggatacatctcttaatcggtttgctgaatttggttcgaat
caggaaatagccaaagcagcaagggagggtctcgacagccatagacagttatgttatgtt
gcctttgatgttctttatgttggcgatactagtgtcatccaccagagtttaacagaacgg
cacggactcctgaggaaagtggtgaagccgttaaaaggccggcttgaagttttagtgcct
gaaggtggtctcaatgttcatcgcccttcaggggaaccaagttggtctattgtggttcat
tctgcagctgatgttgagcggtttttcaaagaaacagttgaaaatagggatgaaggagtt
gtgcttaaagacctgggatcgaaatgggaacctggagatcgcagtggcaagtggttgaag
ttgaagcctgaatatgtccgggctggttctgatctagatgttcttataataggaggatac
tatggctctggccgtcacggaggagaggtagcacagtttctcgttgggttggctgaccgg
gcagaggcaaatgtgtatcccaggcgatttatgtcgttttgtagagttggcacaggactt
tctgatgaagagcttaacactgttgtaagcaaactgaagccttatttcagaaaaaatgaa
cacccaaagaaggccccaccaagcttttatcaggtcacaaatcactcaaaagagagacct
gatgtttggattgaaagcccggaaaaatcaataatactctccatcactagtgacatcagg
acaataaggtctgaggtttttgtcgcaccttacagcctgaggtttcctcgtattgataaa
gtaagatacgacaaaccttggcatgaatgtctcgatgtgcaagcttttgtggaattggtg
aactcaagtaacggcaccacacagaaacagaaggaatccgaaagcatgcaggacaatccg
aaagtcattaaatcgtccaagagaggaggagagaaaaagaatgcgtcacttgtcccatct
cagtttattcaaactgatgtatcggatatcaagggcaagacctcaatcttctccaatatg
atattttattttgtaaacctgcctcggtcccattctcttgatacattccacaaaatggtg
gttgagaatggagggaagttctcgatgaacttaaacaattcagtgactcattgcattgca
gcggaaagcagtggaataaagtatcaggcagcaaaacgtcaaagagatgtcatccacttt
tcatgggtcttagactgttgttcacggaatattctgcttcctttgcagccaaagtacttc
ctccatctcactgatgcttcaaggaccaaattacaggatgaaattgacgagttttccgat
tcttatttctttgatttagaccttgaaggtctcaaacaggtcttgagcaatgccaagcaa
tcggaagactcaaaatccattgaatactacaagaaaaagctatgtccggagaaaagatgg
tcctgcttcatcggttgctgcatttactttcacctctattgtgaaacattgagtattgaa
gaggaagctctgttgggaatcatggctaagagattagcgcttgaagtcttaatgggtggt
ggtaaagttagccataatctttctcatgcctcgcaccttgtagtcctttctacagcagaa
gagactttggattttacttcagtttcaaaaagtttcagcgaaaaggagaaacgtcttttg
ctgaagagaaggctacatgttgttaactcgaactggttagaggacagtttgcaaagagag
caaaaactaagcgaggatgtgtacactctgaggcctaagagtatggaagagtcggatact
gaagaatcagataaatctgaacatgatacaacggaagtagcttccggtgttagtgctcaa
accgaagagccagcttcctcgaaaatggcagttacgagttcaagaggacggtcgagtact
cgagctggtaataaaaggggaaggtcttctacaaactcagtgaaacgagtacagagacgc
agagggaaacagccttctaagataggcggaagtgaaacagaggagagtgatacggcttcg
gaagagaaggcttcaacaagactcagtgatgatatagcagaagagactggtgatactcaa
agaaactctaggagaggaagatctgcaaagagaggaaagtctcgtgtggcacaaccccaa
agagtacagagatcaagaagaggcaacaagcctttgaagataggaggagatgagtctgag
gaaaatgatgattttgatgacaagaaaaatgattccgcggaggaggaaaacaaggaagaa
acaggagagcctgacaaagcaaagcaaagagataacacagtaacagttgaagaggcctcc
tcaaaagattctagaaatgcaaagaccgagatagatagggaagagaagatacaaatccat
gaggatccattacaagcaatgttgatgaacatgatcccaagcctcagtctgagaaacaca
agccgaactacgggcgacgctagtacggctaatgtttgtggtgagagtgagtcttcagag
agaagaaaacttggcgccgagactgataatacgtgtgtgatgaacgcagaggcaggtgaa
gttcctcctcctgtgaagaaaaagaaagttagctaccgcgatgttgcaggagaactgctc
aaagactggtga

DBGET integrated database retrieval system