KEGG   Brassica oleracea (wild cabbage): 106319350Help
Entry
106319350         CDS       T04124                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit 1, mitochondrial-like isoform X1
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
boe  Brassica oleracea (wild cabbage)
Pathway
boe00020  Citrate cycle (TCA cycle)
boe00190  Oxidative phosphorylation
boe01100  Metabolic pathways
boe01110  Biosynthesis of secondary metabolites
boe01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:boe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    106319350
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    106319350
Enzymes [BR:boe01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     106319350
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 106319350
NCBI-ProteinID: XP_013613099
UniProt: A0A0D3E2L9
LinkDB All DBs
Position
C9
AA seq 627 aa AA seqDB search
MWRCVSRSLRAPSSSRTSLSGSRFSRFFSSSQTGDYTIVDHTYDAVVVGAGGAGLRAAIG
LSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMSEDDWRWHMYDTVKGSDWLGDQDAI
QYMCREAPKAVIELENYGLPFSRTEEGKIYQRAFGGQSLDFGKGGQAYRCACAADRTGHA
LLHTLYGQAMKHNTQFFVEYFALDLLMASDGTCQGVIALNMEDGTLHRFRSAQTILATGG
YGRAYFSATSAHTCTGDGNAMVARAGLPLQDLEFVQFHPTGIYGAGCLITEGSRGEGGIL
RNSEGERFMERYAPTAKDLASRDVVSRSMTMEIREGRGVGPHKDHIYLHLNHLPPEVLKE
RLPGISETAAIFAGVDVTKEPIPVLPTVHYNMGGIPTNYHGEVVTIKGDDPDAVVPGLMA
AGEAACASVHGANRLGANSLLDIVVFGRACANRVAEISKPGEKQRPLEENAGKKTIEWLN
KLRHSSGSLPTSSIRLNMQRIMQNNAAVFRTQETLEEGCQLIDKAWESFEDVQVKDRSLI
WNSDLIETIELENLLINASITMHSAEARKESRGAHAREDFTKREDGEWMKHTLGYWEDEK
VRLEYRPVHMDTLDDEIETFPPKARVY
NT seq 1884 nt NT seq  +upstreamnt  +downstreamnt
atgtggcgctgcgtctctcgtagccttcgagctccttcttcatcaaggacctcactctct
ggatctcgcttttctagattcttctcctcttctcagacgggtgattacacgatagtggat
cacacctatgacgcggtggttgttggagctggtggtgctggtctcagggcggccattgga
ttatctgagcatggctttaacaccgcttgcattaccaagcttttccccacacgctcccac
accgtcgctgctcagggtggtataaatgctgcactgggaaacatgtctgaagatgattgg
agatggcacatgtatgatactgtcaaaggcagtgactggcttggtgatcaagatgctatc
cagtatatgtgtagagaggcaccaaaagctgtgattgaacttgagaactacggccttccc
ttttctcgtactgaagagggtaaaatctaccagcgtgcctttggtggtcagagtctcgac
tttggcaaaggtggtcaggcctatcgttgtgcttgcgctgcggatcgaactggacatgct
ctcttgcataccttatatggacaagctatgaagcataacacacagttctttgttgaatac
ttcgctctggatttgctcatggctagtgatggtacttgccagggtgtaattgcactaaac
atggaagacggaacactgcatcgtttccgctccgcacaaacaattttggccactgggggt
tatggcagagcatacttctcagcaacctcagcacatacttgcacaggagatggcaatgcc
atggttgcacgtgccggtcttccactccaggacttggagtttgttcagttccacccaact
ggtatatatggagccggatgtctcatcactgaaggatctcgaggtgaaggtgggatcctt
agaaatagtgaaggtgaacgttttatggaacgatatgctccaactgccaaggatcttgca
tcaagagatgttgtctccagatctatgactatggaaatcagggaaggtcgtggtgtaggg
ccgcataaggatcatatctatctccatttgaatcatcttccaccagaagttctgaaagaa
aggcttcctggaatctctgagacagctgcaatctttgctggtgttgacgttaccaaagag
ccaattccagttttgcccactgtccactacaacatgggtggtattccaacaaattaccac
ggcgaggtagtgaccataaaaggagatgatccagatgcagtggttcctgggcttatggct
gctggggaggcagcttgtgcatctgttcatggtgccaacagacttggtgcaaattctctc
ctcgatattgttgtgttcggccgtgcttgtgcaaatagggttgcagagataagcaaacca
ggtgagaaacagagacctctagaggagaatgcaggtaagaagacgatcgaatggctgaac
aagttaagacactcaagcgggtcgcttcctacatcaagtatcagattgaacatgcagagg
attatgcagaacaatgcagctgtgttccgcacccaagaaacactggaagaaggttgtcag
ttgatcgacaaggcatgggaaagtttcgaggatgtccaggttaaagataggagtttgata
tggaactctgatctgatagagacaatagaactggaaaaccttctgataaacgcgtccata
acaatgcattcagcggaagcacgaaaggaaagcagaggagcacatgctcgggaggatttc
acgaaaagggaggatggagaatggatgaagcatacattggggtactgggaagatgagaaa
gtgaggttggagtataggcctgttcacatggacactctcgacgatgagattgagactttc
cctcccaaagctcgcgtctattga

DBGET integrated database retrieval system