KEGG   Brassica oleracea (wild cabbage): 106320705Help
Entry
106320705         CDS       T04124                                 

Definition
(RefSeq) DNA ligase 1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
boe  Brassica oleracea (wild cabbage)
Pathway
boe03030  DNA replication
boe03410  Base excision repair
boe03420  Nucleotide excision repair
boe03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:boe00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    106320705
   03410 Base excision repair
    106320705
   03420 Nucleotide excision repair
    106320705
   03430 Mismatch repair
    106320705
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:boe03032]
    106320705
   03400 DNA repair and recombination proteins [BR:boe03400]
    106320705
Enzymes [BR:boe01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     106320705
    6.5.1.6  DNA ligase (ATP or NAD+)
     106320705
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     106320705
DNA replication proteins [BR:boe03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   Other elongation factors
    106320705
 Prokaryotic type
   Elongation factors (archaeal)
    Other elongation factors
     106320705
DNA repair and recombination proteins [BR:boe03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     106320705
   NER (nucleotide excision repair)
    Other NER factors
     106320705
   MMR (mismatch excision repair)
    Other MMR factors
     106320705
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-GeneID: 106320705
NCBI-ProteinID: XP_013614525
UniProt: A0A0D2ZT28
LinkDB All DBs
Position
Unknown
AA seq 780 aa AA seqDB search
MLTIRSSNYFRCISSLYTKTLNPKFSSASLSFTRRAPHSPFTSRRHRAMSSSRPSAFDAL
MSNARASAAKKKTPQASNPPRSPNKRKIEKTQDADLVKTETSDSAKPGSDSPSIAEDSKK
GAKKSRSLTQADKIEEMKSKIALLKKKPGDFDPERVSCWEKRERVPFLFIALAFDLISAE
SGRIVITDILCNMLRTVIATTPDDLVATVYLAANEIAPAHEGVELGIGEGSIIKAISEAF
GRTESQVKKLNTELGDLGLVAKGSRSSQTMMFKPESLTVVKVFNTFRQIAKESGKDSTEK
KKDRMKALLVAATDCEPLYLTRLLQAKLRLGFSNQTVLAALGQAAVYNEEHSKPPPNTKS
PLEEAAKIVKQVFTVLPVYDIIVPALLSGGVWNLPKTCNFTLGVPIGPMLAKPTKGVGEI
LNKFQDTVFTCEYKYDGERAQVHCMEDGTFEIYSRNAERNTGKYPDVALALSRLKKPSVK
SFILDCEVVAFDREKKKILPFQILSTRARKNVNVNDIKVGVCIFAFDMLYLNGQQLIQEN
LNIRREKLYESFEEDPGYFQFATTLTSSDIDEIQKFLDASVDIGCEGLIIKTLNSDATYE
PAKRSNNWLKLKKDYMDSIGDSVDLVPIAAFHGRGKRTGVFGAFLLACYDADKEEFQSIC
KIGTGFSEAVLEERSTSLGSRVIATPKQYYRVGDSLNPDVWFEPTEVWEVKAADLTISPV
HRAATGIVDPDKGISLRFPRLLRVREDKKPEDATSSEQIADMYQAQKHNHPSNDAKGEDE
NT seq 2343 nt NT seq  +upstreamnt  +downstreamnt
atgttaacgattcgatcatcgaattacttccgatgcatatcttctctctacactaaaacc
ctaaaccccaaattctcctccgcctcactctcctttacccgccgagctccccactcaccc
ttcacctcgcgccgccacagagccatgtcttcttcacgcccctccgcattcgacgctctc
atgtcgaacgctcgcgcatccgccgccaagaagaagaccccccaagcctccaacccgcct
cgctcgccgaacaagaggaaaatcgaaaaaacccaagacgccgatttggtcaagactgaa
acttctgattccgcgaaacccggatcggattcaccttcaattgcggaggattcgaagaag
ggtgcgaaaaagtctaggtctttgacccaggcggacaagatcgaggaaatgaagagcaaa
atcgcgttgctgaagaagaagcctggggatttcgatccggagagagtgtcgtgttgggag
aaaagggagagagttccgtttctgtttatcgctttggcgtttgatctgatctcagctgaa
agtgggcggattgtgattactgatatcctctgtaacatgttgagaactgttattgctact
actcctgatgatttggtggctactgtttacctcgcggcgaacgagattgctcctgcgcac
gaaggtgttgagttggggattggtgaaggttcaattatcaaggcaatctctgaagctttt
ggtagaactgagtctcaggttaagaagcttaacacggagcttggagacttggggcttgta
gcaaaaggaagccgttcgtctcaaactatgatgttcaagccagagtcattgaccgttgtc
aaggttttcaacacatttcgacaaattgctaaggaaagtggaaaagatagtacagaaaag
aagaaggatcggatgaaggctctccttgtggcagcaacggactgtgaacctctttactta
actcgtttacttcaggcaaaattgcggttagggttctcaaaccagacggtcttagctgcc
ttgggacaagcagctgtatataatgaagagcactctaagccaccccctaataccaagtct
cctttagaagaggctgcgaagattgtgaaacaagtattcactgtgcttcctgtctatgac
attattgtccccgctcttttatctggtggtgtgtggaatcttcctaaaacttgtaacttt
acactcggtgttccaatcggaccaatgcttgcaaaaccaacaaaaggtgtaggtgagata
ctgaataaattccaagacaccgtcttcacatgcgagtacaagtatgatggagaacgtgca
caggtacattgtatggaggatggtacattcgagatatatagtcgaaatgctgaaagaaac
actgggaagtaccctgatgttgctcttgcgttgtcaagattaaagaagccttctgtgaaa
tcttttattctggattgcgaggttgttgctttcgacagggagaaaaagaaaattcttcca
tttcagatattgagcactcgagcccgtaaaaatgtgaatgttaacgatatcaaagttggc
gtatgtatctttgcttttgacatgttatatcttaatggccagcaacttatccaggagaat
cttaatattcgccgagagaagctatacgaatcatttgaggaagatcctggatatttccag
tttgcaacaactctaacatccagcgatattgatgaaatacaaaagtttcttgatgcgtcc
gttgacattggctgtgaagggttaatcattaaaacattgaattcagatgctacctatgag
cctgcaaagcgatcgaataattggctaaaactgaagaaagactatatggacagtattggg
gactctgtggatcttgtaccaatcgctgctttccatggacgtggcaaacgcacaggtgtc
tttggtgcctttttgctagcttgctacgatgctgataaggaagagttccaaagcatttgt
aaaataggcactggattttctgaagccgttcttgaagagcggtctacaagtcttggctct
agagtgattgctactccaaaacaatactaccgagttggagatagcctcaatccagatgtt
tggttcgagcccactgaggtctgggaagtaaaggcagctgacttgacaattagccctgta
catcgtgcagctaccggcattgttgaccctgataaggggatttctctacgttttcctcgt
ttactccgtgtacgagaagacaagaagccagaggatgcaacatcatcagaacagattgct
gatatgtaccaagctcagaaacacaaccatccaagcaatgatgccaaaggtgaagacgaa
tga

DBGET integrated database retrieval system