KEGG   Brassica oleracea (wild cabbage): 106321479Help
Entry
106321479         CDS       T04124                                 

Definition
(RefSeq) uncharacterized mitochondrial carrier C12B10.09-like
  KO
K15111  solute carrier family 25 (mitochondrial S-adenosylmethionine transporter), member 26
Organism
boe  Brassica oleracea (wild cabbage)
Brite
KEGG Orthology (KO) [BR:boe00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:boe02000]
    106321479
Transporters [BR:boe02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   106321479
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mito_carr Serine_protease Peptidase_U4
Motif
Other DBs
NCBI-GeneID: 106321479
NCBI-ProteinID: XP_013615194
LinkDB All DBs
Position
Unknown
AA seq 114 aa AA seqDB search
MVAQALGRELEAWETIAVGAVSGGIAAVVTTPFDVMKTRMMTATPGRPISMSMVAISILR
HEGPLGLFKGAVPRFFWVAPLGAMNFAGYELAKKAMQKNEEVVMADQLGQKKLC
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atggtggcgcaagcgctgggaagagaactggaagcatgggagacaatagcggttggggcg
gtgtcaggaggcatagcagcagttgtaacaacgccatttgatgtgatgaagacgagaatg
atgactgcaacaccagggagaccgatctcaatgtctatggttgctatctcgatcctgcgc
cacgagggaccgcttggtttgttcaaaggagcagtcccgaggttcttctgggtggctcct
cttggtgccatgaactttgctggctatgagctagccaagaaagctatgcagaagaacgag
gaagttgtaatggctgatcagcttggtcagaagaagctttgctaa

DBGET integrated database retrieval system