KEGG   Brassica oleracea (wild cabbage): 106324691Help
Entry
106324691         CDS       T04124                                 

Definition
(RefSeq) glutathione S-transferase U19-like
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
boe  Brassica oleracea (wild cabbage)
Pathway
boe00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:boe00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    106324691
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:boe02000]
    106324691
Enzymes [BR:boe01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     106324691
Transporters [BR:boe02000]
 Other Transporters
  Pores ion channels [TC:1]
   106324691
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_N_3 GST_C_2 GST_N_2 GST_C GST_N_4 GST_C_3 GST_C_5 GST_C_6 Dak2
Motif
Other DBs
NCBI-GeneID: 106324691
NCBI-ProteinID: XP_013618106
UniProt: A0A0D3ARG0
LinkDB All DBs
Position
C2
AA seq 219 aa AA seqDB search
MANEVILLDFWPSMFGMRTRIALREKGIEFEYRDEDLWNKSPLLLETNPVHKKIPVLIHN
GKPVCESTIQVQYIDEVWSDKNPILPSDPYQRAQARFWVDFIDKKMYDAQRKVWGTKGEE
QETGKKEFIELLKTLESELGENTYFGGDDFGYVDIGLIGFYSWFHAYEKYGNLNIESECP
KLIAWAKTCMQRESVAKSLPDSEKVIEFVTEIRKKFMLE
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atggcgaacgaagtgatccttcttgatttctggcctagcatgttcgggatgaggacgagg
atcgcgttgagggagaagggtatcgagttcgagtacagagacgaggacctgtggaacaag
agccctttgcttctcgagacaaatccggttcacaagaagattccggttctcatccacaac
ggtaaaccggtctgcgaatctacaatccaggttcagtacatagacgaggtctggtctgac
aagaaccctatcctcccttctgatccttaccagagagctcaggctagattctgggttgat
ttcatcgacaaaaagatgtatgatgcccaaaggaaggtgtgggggaccaagggtgaggaa
caagagacaggcaagaaagagtttattgagttgctcaagacacttgaatctgagcttgga
gaaaatacttactttggtggtgatgactttggctacgtagacattggattgattgggttc
tactcgtggttccatgcatacgagaagtatggtaacttgaacatcgagtcagagtgtccg
aaactgatcgcttgggctaaaacgtgtatgcagagggagagcgtggctaagtccttgcct
gattctgagaaggttattgagttcgtcactgagatcaggaagaagtttatgcttgagtag

DBGET integrated database retrieval system