KEGG   Brassica oleracea (wild cabbage): 106325355Help
Entry
106325355         CDS       T04124                                 

Definition
(RefSeq) glutamate decarboxylase 4
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
boe  Brassica oleracea (wild cabbage)
Pathway
boe00250  Alanine, aspartate and glutamate metabolism
boe00410  beta-Alanine metabolism
boe00430  Taurine and hypotaurine metabolism
boe00650  Butanoate metabolism
boe01100  Metabolic pathways
boe01110  Biosynthesis of secondary metabolites
Module
boe_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:boe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    106325355
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    106325355
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    106325355
   00430 Taurine and hypotaurine metabolism
    106325355
Enzymes [BR:boe01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     106325355
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-GeneID: 106325355
NCBI-ProteinID: XP_013618859
UniProt: A0A0D3AVD7
LinkDB All DBs
Position
C2
AA seq 493 aa AA seqDB search
MVLSKTASESDVSIHSTFASRYVRTSLPRFEMPENSIPKEAAYQIINDELMLDGNPRLNL
ASFVTTWMEPECDKLMMESINKNYVDMDEYPVTTELQNRCVNMIARLFNAPLGDGEAAVG
VGTVGSSEAIMLAGLAFKRQWQNKRKAQGLPYDKPNIVTGANVQVCWEKFARYFEVELKE
VKLREGYYVMDPEKAVEMVDENTICVAAILGSTLTGEFEDVKLLNDLLVEKNKQTGWDTG
IHVDAASGGFIAPFLYPELEWDFRLPLVKSINVSGHKYGLVYAGIGWVVWRTKSDLPDEL
IFHINYLGADQPTFTLNFSKGSSQVIAQYYQLIRLGFEGYRNVMDNCRENMMVLRQGLEK
TGRFNIVSKENGVPLVAFSLKDSSCHDEFEVAETLRRFGWIVPAYTMPADAQHVTVLRVV
IREDFSRTLAERLVADFEKVLHELDTLPARVHAKMANGKANGVKKTEEETTREVTAYWKK
FVETKKSNKNRIC
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atggttttgtctaagacagcttcggaatctgatgtttcaatccattcaacttttgcttct
cgttacgtccgtacctctctgccacgatttgagatgcctgagaactcgatcccaaaggaa
gcagcgtaccaaatcatcaacgacgagctaatgctcgacggtaaccctaggcttaaccta
gcctcattcgtgaccacgtggatggagccagagtgtgacaagctcatgatggaatccatc
aacaaaaactacgtcgacatggacgagtaccctgtcaccaccgagcttcagaaccgatgc
gtcaacatgatcgcgcgtctcttcaacgcaccgctcggtgacggtgaggctgcggttggc
gtcggcaccgtgggatcatcggaggcgattatgttggctggtttggcctttaagagacag
tggcagaataagcggaaggctcaagggcttccttacgataagcccaatatcgtaaccgga
gctaatgttcaggtttgctgggagaagttcgcaaggtatttcgaggtggagcttaaagaa
gtgaagctaagagaaggatactacgtgatggaccctgagaaggcggtcgaaatggtagac
gagaacacaatctgtgttgcagccattctcggttcaacgttaaccggagaattcgaagac
gttaagctccttaacgacctcctagtcgagaaaaacaagcaaacgggatgggatacgggg
atccatgtggatgcagcgagtggtgggtttattgctcctttcttgtatccagagctggag
tgggatttccggttaccattggttaagagcataaatgtgagtggtcacaaatacggtttg
gtttacgctggaatcggttgggttgtatggagaaccaaatccgatttgcctgatgaactt
atcttccatatcaattatcttggcgctgaccaaccgaccttcactctcaacttctccaaa
ggttcaagtcaagtgattgctcagtactaccagctgattcgtcttggattcgagggatat
cgcaacgtgatggataattgtcgtgaaaacatgatggtcctaagacaaggattagagaag
acaggacgtttcaacatagtctccaaggaaaacggtgttccattagtggcgttctcgtta
aaagacagtagttgccacgacgagttcgaagtggctgagactctccgtcgctttgggtgg
attgttccggcctacacgatgcccgcggatgctcaacatgtcaccgtcctccgagtggtg
attcgagaagatttctctcgaaccttagccgagaggttggtcgcagacttcgagaaggtg
cttcacgagcttgatacgcttccggcaagggttcacgctaagatggccaacggaaaagct
aacggtgttaagaagactgaggaggaaaccacgagggaagttactgcgtattggaagaag
tttgtggagacaaagaagagtaacaagaacaggatttgctaa

DBGET integrated database retrieval system