KEGG   Brassica oleracea (wild cabbage): 106331517Help
Entry
106331517         CDS       T04124                                 

Definition
(RefSeq) ATP-dependent 6-phosphofructokinase 7-like
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
boe  Brassica oleracea (wild cabbage)
Pathway
boe00010  Glycolysis / Gluconeogenesis
boe00030  Pentose phosphate pathway
boe00051  Fructose and mannose metabolism
boe00052  Galactose metabolism
boe01100  Metabolic pathways
boe01110  Biosynthesis of secondary metabolites
boe01200  Carbon metabolism
boe01230  Biosynthesis of amino acids
boe03018  RNA degradation
Module
boe_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:boe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106331517
   00030 Pentose phosphate pathway
    106331517
   00051 Fructose and mannose metabolism
    106331517
   00052 Galactose metabolism
    106331517
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    106331517
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:boe01009]
    106331517
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:boe03019]
    106331517
Enzymes [BR:boe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     106331517
Protein phosphatases and associated proteins [BR:boe01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     106331517
Messenger RNA biogenesis [BR:boe03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     106331517
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK DAGK_cat NAD_kinase
Motif
Other DBs
NCBI-GeneID: 106331517
NCBI-ProteinID: XP_013625348
UniProt: A0A0D3B347
LinkDB All DBs
Position
C3
AA seq 478 aa AA seqDB search
MSSPKIVNGPGGYTLQDVPHLIDYLPDLPTYQNPLKDNPAYSVVKQYFVDTEDTVPEKII
VHKDGPRGIHFRRAGPRQKVYFESDEVHACIVTCGGLCPGLNTVIREIVSSLSHMYGVKR
ILGIDGGYRGFYAKNTIPLTSKVVNDIHKRGGTILGTSRGGHDTKKIVDSIQERGINQVY
IIGGDGTQRGASKIFEEIRKRGLKVAVVGIPKTIDNDIPVIDRSFGFDTAVEEAQRAINA
AHVEAESNENGIGFVKLMGRHSGFIAMYATLASRDVDCCLIPESPFYLEGEGGLFEYIEK
RLKEHGHMVIVLAEGAGQEMMTKSMETNTLEDASGNKVLKDVGLWLSQSIKDHFKKIKMV
MNLKYIDPTYMIRAIPSNAADNVYCTLLAQSAVHGAMAGYTGYTSGLVHGRQTYIPFYRI
TEKQNSVVITDRMWARLLSSTNQPSFLGPKHVSEENKETPPDGENCNGVVDIPQVTKE
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgtctagtccgaagatcgtcaacggtcccggtggttatacactacaagacgttccccat
ctcatcgattatcttcctgaccttccgacttatcagaatccattaaaagacaatccagct
tactcagtggttaagcaatactttgttgatacagaagatactgtacctgagaagattata
gtccacaaggatggtccaagaggaatccatttcagacgcgcgggtccacgccaaaaggtt
tactttgagtccgatgaagtccatgcatgtattgttacatgtggaggtctctgtcctggc
ctcaataccgtgattagagaaatcgtgagcagcttatctcacatgtacggagtaaaaaga
atccttggaatcgatggtggatacagaggtttctatgcaaagaacactatccccttaacc
tctaaagtcgtgaacgatatccacaaacgaggaggaacaatcttgggaacctcacgaggt
gggcatgataccaaaaagattgttgatagcatccaagagcggggtatcaaccaggtttac
atcatcggtggagacggaacacagagaggagcttcaaaaatatttgaggagatcagaaag
cgtggacttaaagttgctgtggttggaataccgaagacgatcgataacgatataccagta
attgatagatcttttgggtttgacactgctgtggaggaggctcaacgagcgatcaacgca
gcacacgttgaagctgagagtaatgagaatggtatcggttttgtaaagcttatgggtcgt
cacagtggattcatagcgatgtatgctacattagcaagcagagatgttgattgctgcttg
attccagagtcaccattttaccttgaaggagaaggtggactctttgagtacatagagaaa
cggctcaaggagcatggtcacatggtgattgttcttgctgaaggagcaggtcaagaaatg
atgacgaaaagcatggagactaatactcttgaggacgcgtctggtaacaaggttcttaaa
gatgtcggcttgtggctatcacaaagcatcaaggatcatttcaagaagatcaagatggtg
atgaatctcaaatatattgatcctacatacatgatcagggcgattccaagcaatgcggca
gacaatgtatactgtacgcttctagctcagagcgcggttcatggtgcaatggctggttac
accggctacaccagtggtcttgtccatggaagacaaacatacatccctttctacaggata
acagagaaacagaacagtgtggtgattacggatagaatgtgggcaaggctgttgtcttct
actaatcagccaagtttcttgggtcctaagcatgtatctgaggagaataaggagacgccg
cctgacggtgaaaactgtaacggagttgtggatattcctcaagtgactaaagagtaa

DBGET integrated database retrieval system