KEGG   Brassica oleracea (wild cabbage): 106333226Help
Entry
106333226         CDS       T04124                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit 2, mitochondrial
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
boe  Brassica oleracea (wild cabbage)
Pathway
boe00020  Citrate cycle (TCA cycle)
boe00190  Oxidative phosphorylation
boe01100  Metabolic pathways
boe01110  Biosynthesis of secondary metabolites
boe01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:boe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    106333226
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    106333226
Enzymes [BR:boe01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     106333226
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 FAD_binding_3 GIDA DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 106333226
NCBI-ProteinID: XP_013627148
LinkDB All DBs
Position
C3
AA seq 632 aa AA seqDB search
MWRFVSRRVRAASRRSESDGALISSQVSTRLFSARSTTRDYTIVDHKYDAVVVGAGGAGL
RAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLG
DQDAIQYMCREAPKAVIELENYGLPFSRTEDGKIYQRAFGGQSLDFGKGGQAYRCACAAD
RTGHALLHTLYGQAMKHNTQFFVEYFALDLIMNSDGICQGVIALNMEDGTLHRFHAGSTI
LATGGYGRAYFSATSAHTCTGDGNAMVARAGLPLQDLEFVQFHPTGIYGAGCLITEGARG
EGGILRNSEGEKFMDRYAPTARDLASRDVVSRSMTMEIREGRGAGPMKDHIYLHLNHLPP
DVLKERLPGISETAAIFAGVDVTREPIPVLPTVHYNMGGIPTNYHGEVITVRGDDSDSIV
PGLMAAGEAASASVHGANRLGANSLLDIVVFGRACANRVAEIQKPGEKLRPLENDAGEKS
IEWLHRLRNSNGSLPTSKIRLNMQRVMQNNAAVFRTQETLEEGCDLIDKTWDSFGDVKVK
DKSLIWNSDLVETMELENLLINACITMHSAEARKESRGAHAREDFTKRDDENWMKHTLGY
WEEGKVKLEYRPVHMNTLDDEVDTFPPKARVY
NT seq 1899 nt NT seq  +upstreamnt  +downstreamnt
atgtggcggtttgtgtctcgtcgcgttcgagctgcgtcgaggagatcggaatctgatggt
gctctcatcagttctcaagtctccacaagattgttctctgctcgttcgacgacaagagat
tatacaatcgttgatcataagtatgacgcggttgttgtaggagcaggtggtgctggactt
agagcagctataggactatcagaacatggttttaacacagcttgcatcactaagcttttt
cctactcgttctcatacagttgctgctcagggaggtataaatgctgcattgggtaatatg
actgaagatgactggcgatggcatatgtatgataccgtcaaaggaagtgactggttaggt
gatcaagatgcaattcagtatatgtgcagggaagctccaaaagctgtgattgagcttgag
aattacgggttgccgttttctcgaacagaagatggaaaaatatatcaacgagcttttggt
ggtcagagtctcgactttggaaaaggtggccaagcataccgttgcgcatgtgctgctgac
cgcactgggcatgctttgttacacactctttatggccaagcaatgaaacataacactcaa
ttctttgttgaatactttgcccttgatttgattatgaacagtgatggaatatgtcaggga
gtcattgcactgaacatggaagatggcactttacatcgtttccacgctggctctacgatc
ttagccactggggggtatggaagagcttatttctcagcaacctcagcacatacatgcaca
ggggatggaaatgccatggtggcacgtgccgggcttccgctacaggacttggagtttgtt
cagtttcatcctactggtatctatggagctggatgtctcattactgaaggagctcgaggc
gaaggtgggattctcagaaacagtgaaggggagaaattcatggaccggtatgctccaaca
gctagagatcttgcttcaagagatgttgtctcaagatctatgactatggagatccgggaa
gggcgtggtgcaggacctatgaaggatcatatttaccttcacctaaaccatctaccacca
gatgttcttaaggagaggcttcctggtatatctgaaactgctgctattttcgcgggtgtc
gatgttacaagagagcctattcctgtgttgcctactgtgcactacaatatgggtggcatt
cccaccaactaccatggagaggtgattactgttagaggtgatgattcagattctatagtt
cctggactaatggctgcaggagaagcagcatctgcatctgtccatggcgccaataggctt
ggtgcaaactcacttcttgacattgttgtttttggccgagcttgtgcaaacagagttgca
gagattcaaaaaccaggcgagaaactgagacctttagagaacgatgctggtgagaagagt
attgaatggttgcaccgactaaggaactcaaatgggtcgcttccaacttctaaaatcaga
ttgaacatgcaaagagtcatgcaaaacaatgctgctgtcttccgtacacaagaaacacta
gaggaaggttgtgatttgatcgataagacttgggacagttttggtgatgtcaaagtgaag
gataagagtttgatatggaactcggatttggtagaaactatggagctggagaatcttttg
attaatgcgtgtataacaatgcattctgctgaggctagaaaggagagtcgtggagcacat
gctcgtgaggatttcacgaaacgagatgatgagaattggatgaagcacacactggggtat
tgggaagaagggaaggtgaaactggagtatagacccgtccacatgaacacattggacgat
gaggttgacactttccctcctaaagctcgagtatattga

DBGET integrated database retrieval system