KEGG   Brassica oleracea (wild cabbage): 106334787Help
Entry
106334787         CDS       T04124                                 

Definition
(RefSeq) alpha-glucosidase
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
boe  Brassica oleracea (wild cabbage)
Pathway
boe00052  Galactose metabolism
boe00500  Starch and sucrose metabolism
boe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:boe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    106334787
   00500 Starch and sucrose metabolism
    106334787
Enzymes [BR:boe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     106334787
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 106334787
NCBI-ProteinID: XP_013628604
UniProt: A0A0D3B0N8
LinkDB All DBs
Position
C3
AA seq 898 aa AA seqDB search
MSETKIKMSPTQWLPTILTVVFFFWSVTLPSHGSSQVGYGYVVSSVAVDSNQKVLTAKLD
LIKPSSVYAPDVQTLNLHVSLETSERLRIRVTDSTQQRWEIPETVIPRTVNHSPRRYLTE
ENNTLEDPSSDLVFTLHKTTPFGFSVSRRSSGDVLFDASPDPSDPNTYFVFKDQFLQLTY
ALPESRSNLYGLGEHTMRSFKLIPVDTLTLWNADIGSENADVNLYGSHPFYMDVRGSNGH
DDAGTSHGVLLLNSNGMDVRYDGSRITYNVIGGIIDLYVFAGPSPEMVMNQYTEFVGRPA
PMPYWSFGFHQCRYGYNNVSDLESVVDGYAKAGIPLEVMWTDIDYMDGYKDFTLDPVNFP
EDKMKSFVDTLHKNGQKYVLILDPGIGVNSSSYGTFTRGMEADVFIKRDGEPYLGEVWPG
KVYYPDFLNPAAATYWSNEIKMFLETLPLDGLWLDMNELSNFITSPPSPGSSLDDPPYQI
NNLGGRASINKKTVPATAIHFGNVSEYDAHNMYGLLEAKATHQAMEDITGKRPFLLSRST
FVSSGKYTAHWTGDNAAKWEDLAYSIPGMLNFGLFGIPMVGADICGFADDTTEELCRRWI
QLGAFYPFARDHSSKGTARQELYLWDSVAASARKVLGLRMRLLPHLYTLMYEAHVSGVPI
ARPLFFSFPRDTNTYEISSQFLIGKSIMISPALEKGTVSVDAYFPAGNWFDMFNYSFAVG
GSSGKRVSLDTPPDHVNVHVREGSIVAMQGEAMTTREARTKPFELLVVASKLENISGQLF
LDDGENIRMGEEGGNRDWTLVKFRCYVNGKSVVLRSEVVNPEYASRMKWSIGKVTFVGFE
NVESMKTYEVRTGERLRGPRISLLKTVVDDDDPKFMSVEVSRLSLLVGKKFEMRLKLT
NT seq 2697 nt NT seq  +upstreamnt  +downstreamnt
atgtcggaaaccaaaatcaagatgtcacctacacagtggctacccactatcctcaccgtt
gtcttcttcttctggagcgtaactctaccctcacatggaagctcacaagttggatacggc
tacgtcgttagctcagtggccgttgactcaaaccagaaagtcttgacggcgaagcttgat
ctgatcaaaccatcgtccgtttacgcaccagatgttcaaacgctgaatcttcatgtcagc
ttggagacaagtgagcgtttgagaatcagagtaacagactcaactcaacaaagatgggag
ataccggaaaccgttatccctcgcaccgtaaaccactctcctcgccgttacttaacggaa
gagaacaataccttggaagatccatcatcggacttagttttcacactccacaaaacgacg
ccgttcggtttctccgtctcaagacgctcctccggcgacgtcctcttcgacgcgtcgccg
gatccatcggatccaaacacctacttcgtcttcaaggaccagttccttcaactaacctac
gccttaccggaatcccgatcgaatctgtacggtctcggagagcacacgatgcgatcgttc
aagctgatcccggtagatacactgactctgtggaacgctgacatcgggagcgagaatgcg
gatgttaacctctacggatcgcatccgttctacatggatgtgagaggatctaacggtcac
gatgacgccgggacgagtcacggcgttctcttgctgaacagtaatgggatggatgtgagg
tatgatggaagtcggattacgtataatgtgatcggaggtatcatcgatctctacgtgttc
gccggaccgtcgcctgagatggtgatgaatcagtatacagagtttgttggacgacctgca
cctatgccttattggtcatttggattccatcagtgtcggtatggatacaacaatgtttca
gaccttgaatccgtggttgatggatatgcaaaagctggaataccacttgaagttatgtgg
acagacattgattacatggatggctacaaagacttcactttggaccccgtgaacttccct
gaggacaagatgaaatcattcgtggatacacttcacaagaacggtcagaagtacgtgctg
atcttggatccaggcattggtgtgaatagctcctcttacgggacgtttactagaggaatg
gaagcagatgtgttcataaaacgagatggtgagccttatctcggtgaagtttggcctggg
aaagtatattaccctgacttcttgaatccagctgctgcaacttactggagcaacgaaatc
aagatgttcctggaaactctccctttggatggtctgtggcttgacatgaacgagttgtca
aatttcataacttcacctccatcccctggatcttcactcgatgatcctccttaccagatt
aacaacttagggggcagagcttctatcaataagaagacagtaccagcaacagctatccat
tttgggaacgttagtgaatacgatgcgcataatatgtatggactcttggaagctaaagcc
actcaccaagctatggaggatataactggaaagagaccgtttcttttgtcgagatccacg
ttcgtaagctcggggaagtacacagctcattggacaggagataacgctgcgaaatgggag
gacttggcttactcgatcccggggatgctcaactttggactgtttgggatcccaatggtt
ggagctgatatctgtggtttcgcagatgataccactgaggagttatgtcgtcgatggatc
cagcttggagcgttttacccttttgcaagagatcattcttccaaaggtactgctagacaa
gaactatacctatgggactcggttgctgcttccgcaagaaaggttctcggccttcgtatg
agactcctcccgcatctctacacactaatgtacgaggctcacgttagcggcgtccctata
gcgcggccgctcttcttctccttccctagagacactaacacctatgagatcagttcgcag
ttcttgatcggtaaaagcataatgatatctccggcgctggagaaagggacagtgtccgtc
gatgcatacttccccgccgggaactggttcgacatgtttaactattcgtttgccgtcggt
ggaagttccggcaagcgcgttagtcttgatactccccctgatcacgtcaatgtccatgtt
cgagaaggtagcattgtggctatgcaaggagaagcaatgacaactagagaagccagaacg
aaaccatttgagcttctagttgtagccagcaagcttgagaacatctcgggccaactgttt
ctcgatgatggcgaaaacatacggatgggagaggaaggagggaaccgtgactggaccctg
gtgaagttccgttgctacgtaaacggaaaatccgtggtgctgagatcagaagtggtgaac
ccagagtacgcgtctaggatgaaatggagcatcgggaaagtgacgttcgtcgggtttgag
aacgtggagagcatgaaaacgtacgaggttaggacaggggagaggttgagagggccgaga
atctctcttctcaagacggttgtggacgatgatgatcccaagtttatgagtgtggaggtt
tctagactgtcgctgcttgttgggaagaagttcgagatgcgattgaaattgacttaa

DBGET integrated database retrieval system