KEGG   Brassica oleracea (wild cabbage): 106334995Help
Entry
106334995         CDS       T04124                                 

Definition
(RefSeq) phosphoenolpyruvate carboxylase 1
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
boe  Brassica oleracea (wild cabbage)
Pathway
boe00620  Pyruvate metabolism
boe00710  Carbon fixation in photosynthetic organisms
boe01100  Metabolic pathways
boe01200  Carbon metabolism
Module
boe_M00168  CAM (Crassulacean acid metabolism), dark
boe_M00170  C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
boe_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
boe_M00172  C4-dicarboxylic acid cycle, NADP - malic enzyme type
Brite
KEGG Orthology (KO) [BR:boe00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    106334995
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    106334995
Enzymes [BR:boe01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     106334995
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-GeneID: 106334995
NCBI-ProteinID: XP_013628861
UniProt: A0A0D3BMV8
LinkDB All DBs
Position
C3
AA seq 964 aa AA seqDB search
MPHGKLEKMASMDVHLRQLVPGKVSEDDKLVEYDALLLDRFLDILQELHGEDLRETVQEL
YEHSAEYEGKHEPKKLEELGNVLTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRIK
KLKKGDFVDESSATTESDLEETFKKLVGDLNKSPEEIFDALKNQTVDLVLTAHPTQSVRR
SLLQKHGRIRDCLAQLYAKDITPDDKQELDEALQREIQAAFRTDEIKRTPPTPQDEMRAG
MSYFHETIWKGVPKFLRRVDTALKNIGIKERVPYNAPLIQFSSWMGGDRDGNPRVTPEVT
RDVCLLARMMAATMYFNQIEDLMFELSMWRCNDELRVRADELHVNRRKDAAKHYIEFWKS
IPPTEPYRVVLGDVRDKLYHTRERARQLLSNGTSDVPEEATFNNLEEFLEPLELCYRSLC
SCGDRPIADGSLLDFLRQVSTFGLSLVRLDIRQESDRHTDVLDAITTHLEIGSYRDWSEE
RRQEWLLSELSGKRPLFGSDLPKTEEIADVLDTFHVIAELPSDSFGAYIISMATAPSDVL
AVELLQRECHVKRPLRVVPLFEKLADLEAAPAAVARLFSVDWYKNRINGKQEVMIGYSDS
GKDAGRLSAAWQLYKAQEELVKVAKEYGVKLTMFHGRGGTVGRGGGPTHLAILSQPPDTI
NGSLRVTVQGEVIEQSFGEEHLCFRTLQRFTAATLEHGMRPPVSPKPEWRELLDEMAVVA
TEEYRSVVFQEPRFVEYFRLATPELEYGRMNIGSRPSKRKPSGGIESLRAIPWIFAWTQT
RFHLPVWLGFGAAIRHVVEKDVKNLHMLQDMYQHWPFFRVTIDLIEMVFAKGDPGIAALY
DKLLVSEELWPFGDKLRANFEETKKLVLQTAGHKDLLEGDPYLKQRLRLRNSYITTLNVC
QAYTLKRIRDPSYNVTLRPHISKEIAESSKELIELNPTSEYAPGLEDTLILTMKGVAAGL
QNTG
NT seq 2895 nt NT seq  +upstreamnt  +downstreamnt
atgcctcatgggaagttagagaagatggcatcgatggatgtccatctccgtcagttggtt
cctggcaaagttagtgaagacgacaaacttgtcgagtacgatgctctgcttctagatcgg
ttcctcgatatcctccaggagttgcacggcgaggatcttcgtgaaactgttcaagagctc
tatgagcactctgcagagtacgaagggaagcatgagccaaagaagctagaggagctaggc
aatgttctcacgagcttagatccaggagactccattgttatcgctaaagccttctcccac
atgctcaacttggctaatctggctgaggaagtgcagattgcttaccgtcgtaggatcaag
aagctgaagaaaggtgacttcgttgatgagagctctgctactaccgagtctgatctcgag
gagactttcaagaagcttgttggtgatctcaacaagtctcctgaagagatctttgatgct
ctcaagaatcagactgttgatttggttttgactgcgcatcctactcagtccgtgagaaga
tctttgcttcagaaacacgggaggataagagactgtctggctcagctctatgctaaggat
atcactcctgatgacaagcaagagcttgatgaggctctacagagagagattcaagctgca
ttcagaacagatgaaatcaaaagaacaccaccaacgcctcaggatgagatgagagctggg
atgagttacttccatgaaactatatggaaaggtgttcctaagtttcttcgccgtgtagac
actgctctcaaaaacatcggtatcaaagagcgtgtcccatacaacgctccactgattcag
ttctcttcttggatgggtggtgaccgtgatggtaacccaagggtgacacctgaagtcact
agagatgtgtgtttgctggctagaatgatggctgctactatgtactttaaccaaatcgaa
gatcttatgtttgagctgtctatgtggcgttgcaatgatgagctgcgcgtccgtgctgat
gaacttcatgtaaacaggaggaaagacgctgcaaaacattacattgagttctggaagtca
attccaccaaccgaaccataccgtgtggttcttggtgacgtaagggacaagctttaccac
acacgtgaacgagctcgtcaactgctcagcaatggaacctctgatgtccccgaggaagct
actttcaacaacttggaagagttcttggaaccgcttgagctttgttaccgatcactatgc
tcatgtggtgaccgtccaatagctgacggaagccttcttgatttcttgagacaagtctca
acctttggactctctcttgtgcgccttgacataaggcaagaatcagaccgccacaccgat
gtactggacgctatcacaacgcatctagagatcggatcgtacagagattggtccgaagag
cgccgccaagaatggcttttgtctgagctaagtggcaaacgtcctctcttcggttctgac
cttcctaaaaccgaagagatcgctgacgttctcgacactttccatgtcatagccgagctt
ccttcagacagcttcggtgcctacatcatctccatggcgacggctccttctgatgtgtta
gccgttgagcttttgcagcgcgagtgtcacgtgaaacggcctttgagagttgtccccctc
tttgagaagctagctgatctggaagcggctcctgcggcggttgcgaggctcttctccgtt
gattggtacaagaaccggatcaacggtaagcaagaggtcatgatcggttattcagactca
ggcaaagacgctggtcgtctctctgctgcttggcagctgtacaaagctcaagaggagctt
gtgaaggttgctaaagagtacggtgtgaagctgacgatgtttcacggccgtggtgggact
gttggaagaggaggcggaccgactcatcttgctatattgtctcagccgccggatactatc
aacggctcgctccgtgtcacggttcaaggtgaagtcattgagcagtcttttggagaggag
catctgtgctttagaacgcttcagcgttttactgctgcaacgcttgagcatgggatgcgt
cctccggtttctcctaaaccggaatggcgcgagttgctagatgaaatggcggttgttgcg
accgaagagtaccggtctgttgtgttccaagagcctcgctttgtcgagtacttccgcctt
gccacaccggagctagagtatggtcgtatgaacataggaagcaggccttcgaagaggaag
ccaagcggcggcatcgagtctctccgtgccattccatggatctttgcttggactcaaacg
agattccatctccctgtgtggcttggattcggagcagcgatcaggcacgtggttgagaaa
gacgtcaagaacctacacatgcttcaggacatgtaccaacactggcctttctttagagtc
accattgatctaatcgaaatggtgttcgctaaaggagatccaggtatcgctgccttgtac
gataagcttcttgtttcagaggagctttggccttttggtgacaaactcagagctaacttc
gaagagaccaagaaactcgtcctccagactgctgggcacaaggatctgcttgaaggcgat
ccttacttgaagcagagactgagacttcgtaactcttacatcaccacactcaatgtctgt
caagcttacacactgaagaggatccgtgacccgagctacaatgtgactctacggcctcac
atctctaaggagatcgctgaatcgagcaaggaactcatcgagcttaacccgacgagcgaa
tacgcgcctggacttgaagatacactcatcttgaccatgaagggtgtcgctgctggtcta
cagaacactggttga

DBGET integrated database retrieval system