KEGG   Brassica oleracea (wild cabbage): 106335079Help
Entry
106335079         CDS       T04124                                 

Definition
(RefSeq) thymidine kinase-like
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
boe  Brassica oleracea (wild cabbage)
Pathway
boe00240  Pyrimidine metabolism
boe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:boe00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    106335079
Enzymes [BR:boe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     106335079
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TK AAA_14
Motif
Other DBs
NCBI-GeneID: 106335079
NCBI-ProteinID: XP_013628957
UniProt: A0A0D3BA80
LinkDB All DBs
Position
C3
AA seq 246 aa AA seqDB search
MATLNKASSLPRIHDNDISQDVISDQKLRGSGAIHVITGPMFSGKSTSLLRRIKSEISLG
RSVAMVKSSKDTRYAKDSVVTHDGIGFPCWAIPDLMSFPDMFGQDAYDKLDVIGIDEAQF
FGDVYEFCCKAADDNGKTVIVAGLDGDYLRRRFGALLDIVPIADSVTKLTARCEVCGQKA
FFTLRKTCDTKTELIGGADVYMPVCRKHYVNNQIVIKASKKVLDSDKERAKPCVETVDVD
PSITGY
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atggccactctcaacaaagcttcgtctttgcctagaatccacgacaacgacatctctcaa
gatgttatctccgatcagaaacttcgcgggtccggtgcgattcatgttatcacgggtccg
atgttttctgggaagtcgacctctctcctccgccgaatcaaatcagagatcagcctcgga
agaagcgttgcgatggtgaaatcgagcaaggacacgagatatgctaaagattcagtggtg
acgcatgacggaattggattcccttgctgggctattccagatcttatgtcgtttccagac
atgttcggacaagatgcttatgacaagcttgatgtgattggtattgacgaggcacagttc
tttggagatgtttatgagttttgctgcaaagccgctgatgataatggcaaaactgtgatt
gttgcaggccttgatggtgattacttaaggaggagatttggtgctcttcttgatattgta
ccaatagctgattctgtgacgaagttaactgcaaggtgtgaggtttgtgggcaaaaagct
ttcttcactctcagaaagacttgtgacaccaaaactgagctgattggtggtgctgatgtc
tatatgccggtttgtcgcaagcactacgttaacaatcaaattgttatcaaagcttcaaag
aaagtgttggattctgacaaggaaagagctaagccctgtgtggaaacagttgatgttgac
ccatctataactggctattga

DBGET integrated database retrieval system