KEGG   Brassica oleracea (wild cabbage): 106336916Help
Entry
106336916         CDS       T04124                                 

Definition
(RefSeq) superoxide dismutase [Cu-Zn] 2, chloroplastic
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
boe  Brassica oleracea (wild cabbage)
Pathway
boe04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:boe00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    106336916
Enzymes [BR:boe01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     106336916
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu CHRD
Motif
Other DBs
NCBI-GeneID: 106336916
NCBI-ProteinID: XP_013631348
UniProt: A0A0D3C2I5
LinkDB All DBs
Position
C4
AA seq 207 aa AA seqDB search
MASHTFLSFSSPPRLLVSPPSTLRSSFGGVSLNLHRPQSVSFSASKKSLTVVSAAKKAVA
VLKGNSDVEGVVTLTQEDTGPTKVSVRITGLTPGPHGFHLHEFGDTTNGCISTGPHFNPN
NMTHGAPEDEIRHAGDLGNITANADGVVETTLVDNQIPLTGPNSVVGRAFVVHELKDDLG
KGGHELSLTTGNAGGRLACGVVGLTPL
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atggcttctcacaccttcctctccttctcatcgcctccgcgcctcctcgtttcccctccg
tccactctccgttcctctttcggcggcgtctctctgaacctccaccgcccccagtctgtt
tccttctcggcctcgaagaaatcgctgacagtcgtttccgccgcgaagaaagctgttgct
gtgctcaagggtaactccgacgtcgaaggagttgttactttgacacaagaagacacaggt
cctacaaaagtgagcgttcgtatcaccggtctcacaccagggcctcatggctttcacctc
catgagtttggtgatacaacaaatggatgcatctcaacagggccacatttcaaccctaac
aacatgacacacggagctcctgaagacgagatccgtcatgcgggtgacctgggaaacatt
actgccaacgccgatggcgtggtagaaacaacacttgtggacaatcagattcctctgact
ggtcctaactctgttgttggaagagcctttgtggttcacgagcttaaggatgacctcgga
aagggtgggcatgagcttagcctgaccactggaaacgcaggcgggagattggcatgcggt
gtggttggtttgacgccgctctaa

DBGET integrated database retrieval system