KEGG   Brassica oleracea (wild cabbage): 106339490Help
Entry
106339490         CDS       T04124                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 4-like isoform X1
Organism
boe  Brassica oleracea (wild cabbage)
SSDB OrthologParalogGFIT
Motif
Pfam: CDI
Motif
Other DBs
NCBI-GeneID: 106339490
NCBI-ProteinID: XP_013633771
UniProt: A0A0D3BSQ4
LinkDB All DBs
Position
C4
AA seq 239 aa AA seqDB search
MGKYMRKSKIDGEAISLLEVSPSSPSSSLGVLTRAKSLALQRKPSSSFSLPTSPSPSPNQ
KTSDCGGSYLQLRSRRLQKKPPIVVIKRRKQQQRRKESCGRSPKPDSVVESGVGSKEKVL
NDEINNKGSTSLEENLLELQGNESLNRSTSESTPCTLKREAEINTSLGSSTKLNNGISDN
SDQIEENLSGSHRPTTPDMDRFFSGAEEEQQKQFIEKYNFDPVNEQPLPGRFEWEKVDN
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atggggaaatacatgaggaagagcaaaatcgacggagaagcaatatctttgctggaagta
tctccttcttctccttcttcttccctcggtgttcttactcgagctaagtccttagcgctc
caacgaaagccctcctcttccttctcgctaccgacttctccttctccttctcctaatcag
aagacgagtgattgtggcggctcctatcttcagctaaggagtcgacggctccagaagaaa
cctccaattgttgtgatcaaacggagaaagcagcagcagcggaggaaagagtcttgcggc
cgaagccctaagccagattcagttgttgagagtggtgtcggtagcaaagagaaggtatta
aatgatgaaatcaacaacaagggttcaacttcgcttgaggagaatttattggagcttcag
ggtaatgaaagcttaaacaggagcacaagtgaatccacaccatgcactttgaaaagagag
gctgagatcaacacaagtctgggatcgtccacaaagcttaacaatggtattagtgacaac
agcgaccaaatagaagagaacttgtcgggcagtcaccgtccaactacgcctgatatggac
aggtttttctcgggtgcagaagaagaacaacagaagcagttcattgaaaagtacaacttt
gaccctgtgaacgaacaaccactaccaggaaggtttgaatgggagaaggtagataattaa

DBGET integrated database retrieval system