KEGG   Brassica oleracea (wild cabbage): 106342758Help
Entry
106342758         CDS       T04124                                 

Definition
(RefSeq) histone-lysine N-methyltransferase CLF isoform X1
  KO
K11430  histone-lysine N-methyltransferase EZH2 [EC:2.1.1.43]
Organism
boe  Brassica oleracea (wild cabbage)
Pathway
boe00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:boe00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    106342758
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:boe03036]
    106342758
Enzymes [BR:boe01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     106342758
Chromosome and associated proteins [BR:boe03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     106342758
   Polycomb group proteins
    PRC2-EZH2 complex
     106342758
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET TCR
Motif
Other DBs
NCBI-GeneID: 106342758
NCBI-ProteinID: XP_013637234
LinkDB All DBs
Position
C4
AA seq 909 aa AA seqDB search
MASGASPSSSATRSDPHKHSTTSQAEKRAPASKEVAAVIDSLKKKLAADRCISIKKRIDE
NKKNVRGITQSTMRSCMERGGGSYKDGSDLLVKRQRDSPGMKSGLNASDADKSNNHSSFL
EDGNASSTTMVQGSSVPVKISLRPIKMPDVKRLSPYTTWVFLDRNQRMTEDQSVVGRRRI
YYDQTGGEALICSDSEEEAIDEEDEKRAFVEPEDFIIRMTLDQLGLSDSVLEELANFLSR
SSSEIKARYEVLMKEKEVSESGDNQAESSLLNKDMDGALDSFDNLFCRRCLVFDCRLHGC
SQDLIFPAEKPAPWTTPVDENLTCGANCYKTLLKSNRIPANGTTEDKTGTSSDGAGTKTT
SKFSGKLSRKKTKTFPSESASSNEKCTPETSDSENGVQQDTNPEKVSSSSKVKASGRRGG
RKRNNNRVAERVSRRTQKRQKKSEASDTDSIATGSRSASDAKHKDNEDATSSSQKHVKSG
SSKNSRKNDTPVEDSKNSVKGDDPVSQLNAVASEPCSDGSLRKEEFVGENVCPGGLSEDK
SWRPLEKSLFQKGVEIFGMNSCMIARNLLCGLKSCWEVFQYMTCSENKASLFGGDALNPD
GSSKFDINGNMTNNQVRRRSRFLRRRGKVRRLKYTWKSAAYHSIRKKSTDKKDQPCRQFN
PCNCKTACGKECTCLLNGTCCEKYCGCPKSCKNRFRGCHCAKSQCRSRQCPCFAADRECD
PDVCRNCWVIGGDGTLGVPSQRGDNYECRNMKLLLKQQQRVLLGISDVSGWGAFLKNSVS
KHEYLGEYTGELISHKEADKRGKIYDRENSSFLFNLNDQFVLDAYRKGDKLKFANHSPEP
NCYAKVIMVAGDHRVGIFAKERILAGEELFYDYRYEPDRAPAWARKPEASGSKKDENVTP
SVGRPKKVA
NT seq 2730 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgggagcttcgccttcttcttccgccaccagatcggacccgcacaagcactct
acgacatctcaggcggagaagagagctccagcgtctaaggaagttgcagcagtcatagat
tcgcttaagaagaagcttgcagctgatcggtgtatctcaattaagaaaaggattgatgag
aacaagaagaatgtgcgtggcattactcaatccactatgaggtcgtgtatggaaagagga
ggcggtagctataaagacggtagtgatctcttggttaagaggcaaagagattcgcctggt
atgaaaagcggactcaatgcaagtgatgctgataagagcaacaaccatagcagcttctta
gaagatgggaatgccagttcaacaaccatggttcaagggtccagtgtccctgttaagatt
tccttgcgcccaatcaaaatgcctgatgttaaacgtttgtcgccttataccacatgggtt
tttctggataggaatcaaagaatgactgaagaccagtctgtagtgggtcgaaggagaatc
tattatgaccaaaccggcggggaagcactcatttgcagtgatagtgaagaggaggcaatt
gacgaggaagatgaaaaaagagcttttgtggagcctgaagattttattattcgcatgacc
cttgaccaactaggtctttcagactctgtcttggaggaactagcaaatttcttgtccaga
agctctagtgaaataaaggcaagatatgaagtgcttatgaaggaaaaagaagtatcagag
agtggcgataatcaagcagagagttctcttcttaacaaagatatggatggagcattggat
tctttcgacaacctgttctgccgtcgatgccttgtgtttgattgccggctgcacgggtgt
tcgcaggatcttatatttcctgctgagaaaccagctccatggactactcctgtggatgaa
aatctaacctgtggcgcaaactgctataaaacgcttctcaaatctaatagaattccagca
aatggcaccactgaagataaaactggcacttcatcagatggtgcgggtactaaaaccact
tccaagttctccggcaaacttagtaggaaaaaaacaaaaaccttccctagcgaaagcgcg
tcgtctaatgaaaaatgcacgccggaaacaagtgactcagagaacggcgttcagcaggat
accaatcctgagaaagtttcatcgtcatcaaaggtgaaagctagtgggagacgtggaggt
cgtaagaggaacaacaaccgagttgctgagcgagtttctcgtaggactcaaaagaggcaa
aagaagtcagaagcttccgatactgattccatcgccaccgggagtcgttcagcaagcgat
gcaaaacataaagataatgaagatgctacatcctcttctcagaagcatgtaaaatctggg
agctctaagaattcaagaaagaatgacactcctgtagaagactccaagaattctgtgaag
ggtgacgatcctgtttcacagttaaatgctgttgcatctgaaccgtgtagcgatggaagt
ttaaggaaagaagagtttgtgggtgaaaatgtatgtccaggaggactgtctgaagataaa
tcgtggagaccacttgagaaaagccttttccaaaaaggtgttgagattttcggaatgaat
agctgcatgattgctaggaaccttctgtgtggtctgaagtcgtgttgggaggtcttccaa
tacatgacttgctcggagaacaaagcttccctctttggaggtgatgcattgaatcccgat
ggctcttccaagttcgatatcaatggaaatatgactaataaccaagtgcggagaaggtca
agatttctacgtagaagaggcaaagtgcgccggttgaagtatacttggaagtctgctgca
tatcattcaattaggaaaaagagtactgataagaaagaccagccgtgccgtcaattcaat
ccatgcaactgcaaaactgcttgcgggaaggaatgtacttgtttgctaaacggaacttgc
tgcgagaagtactgcggttgcccaaagagctgcaagaacaggtttagaggttgtcattgt
gccaaaagccagtgtcggagccgtcaatgtccgtgctttgctgcagatcgggaatgtgat
cctgatgtttgtaggaattgctgggtcattggtggggatggtacgcttggggtccctagc
caaagaggcgataattatgagtgcaggaatatgaaattactcctgaagcaacaacaaagg
gttctacttggaatatctgatgtttctggttggggagctttcttaaagaacagtgtaagt
aagcacgaatatctcggggaatacacaggagagctgatatcacataaagaagcagataaa
cgagggaagatatatgatcgcgagaattcctcttttctcttcaatctaaatgatcagttt
gtgctcgatgcttataggaaaggagacaaactgaaatttgccaatcattcccctgaacct
aattgttacgcaaaggtcattatggttgctggagatcatagagtgggtatttttgcaaag
gagaggatattggctggagaagaactgttttatgattacaggtatgagccagatcgagct
cctgcttgggccagaaaacccgaagcttcaggttctaagaaagatgaaaatgttacacct
tctgttggtagacccaagaaggttgcttag

DBGET integrated database retrieval system