KEGG   Brassica oleracea (wild cabbage): 106343057Help
Entry
106343057         CDS       T04124                                 

Definition
(RefSeq) alpha-amylase 1
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
boe  Brassica oleracea (wild cabbage)
Pathway
boe00500  Starch and sucrose metabolism
boe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:boe00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    106343057
Enzymes [BR:boe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     106343057
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amyl_C2 Alpha-amylase Glyco_hydro_70
Motif
Other DBs
NCBI-GeneID: 106343057
NCBI-ProteinID: XP_013637639
UniProt: A0A0D3A874
LinkDB All DBs
Position
C1
AA seq 435 aa AA seqDB search
MKNTDNSQQNNNMACLNAKLLFSFLLVFFPTFTVSTLLFQGFKWESWMKEGGFYNSLHNS
IDDLSNSGITHIWLPPPSQSVSPEGYLPGKLYDLNSSKYGSEAELKSLIAALKQKGIKAV
ADIVINHRTAARKDDHCGYCYFEGGTSDDRLDWDPSFICRGDTNYAGTGNPDTGEDYKPA
PDIDHLNPRVQKELSEWMNWLKSEIGFSGWRFDFVRGYAASVTKSYVQNTSPDFAVGEKW
DDMKYGGDGKLEYDQEEHRSGLKHWIEEGGGGVLTAFDFTTKGILQSAVGGELWRLKDSQ
GKPPGLIGIMPGNAVTFVDNHDTIRPNSWAFPSDKVLLGYVYILTHPGTPCIFYSHYIEW
GLKDSISKLVAIRNRNGIGSTSSVMIKAAEAELYLAMIDEKVIMKIGPKLDIGTLVPPNF
VLAYSGLDFAVWEKK
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatacagacaattcacaacagaacaacaacatggcttgtctgaatgcaaaacta
ctcttctctttcctcctcgtcttcttccccaccttcacggtttccaccttgttgtttcag
ggtttcaagtgggaatcatggatgaaagaaggaggattctacaactctcttcacaactcc
atcgacgaccttagcaactctggaatcactcatatttggcttcctcctccttctcaatcc
gtttctcctgaagggtatttacctggaaagctatacgatttaaacagctccaagtacggt
tcagaggcggaactgaagtctttgatcgcagcactgaaacagaaagggatcaaagctgtg
gctgatattgtgatcaaccacagaacggctgcgaggaaagacgatcactgtgggtactgt
tatttcgaaggcgggacttccgatgatcgtttagattgggatccttccttcatctgtcgc
ggcgatactaactacgcgggtactggaaaccctgacaccggggaagattataagccggcc
ccggacatcgaccaccttaaccccagggttcagaaagagctgtcggaatggatgaactgg
ctcaagtccgagatcggattcagtggttggagattcgattttgttagaggctatgcagct
tccgtcaccaaatcatacgttcagaatacttcacccgattttgcggttggtgagaaatgg
gacgatatgaagtacggaggagatggtaaactggagtatgatcaggaggagcatcgctcg
ggtcttaaacactggatcgaggaaggtggtggtggtgtactgacagcttttgatttcacg
acgaaagggatcttacagtctgcagtaggaggtgagctttggagactaaaagactctcag
ggaaagccacccggtcttatcggaatcatgcccggaaacgcagtgacgttcgtagataac
cacgacactatcagaccaaactcgtgggcttttccttcggataaagtcttgcttggatac
gtttatattcttactcaccctggcaccccttgcatcttttatagtcattacatcgaatgg
ggtctaaaagatagtatctcgaagttggtggcgatcaggaatagaaatggtattggtagt
acaagctctgttatgatcaaagcggccgaggcggagctctacttggctatgattgatgaa
aaggttatcatgaagattgggccaaaactggatataggaactctcgttcctccaaatttt
gttttagcctattcaggtcttgattttgctgtatgggagaagaagtga

DBGET integrated database retrieval system