KEGG   Bordetella sp. H567: AKI39_02825Help
Entry
AKI39_02825       CDS       T04979                                 

Definition
(GenBank) ribonuclease II
  KO
K01147  exoribonuclease II [EC:3.1.13.1]
Organism
boh  Bordetella sp. H567
Brite
KEGG Orthology (KO) [BR:boh00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:boh03016]
    AKI39_02825
Enzymes [BR:boh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.13  Exoribonucleases producing 5'-phosphomonoesters
    3.1.13.1  exoribonuclease II
     AKI39_02825
Transfer RNA biogenesis [BR:boh03016]
 Prokaryotic type
  3'processing and CCA adding factors
   3'processing factors
    AKI39_02825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNB UPF0086 Caskin-tail
Motif
Other DBs
NCBI-ProteinID: AOB33353
UniProt: A0A1B2R8S7
LinkDB All DBs
Position
complement(640136..642052)
Genome map
AA seq 638 aa AA seqDB search
MHVFYEDDGQFKAGHIISETDASLQVESESGKRSKIKRANAIFTFSTPEPVELLRQAEAA
AEDIDLQFLWECAPQEEFDSPALAADYYGHAPSPTEQAALLMRLHGAPAYFHRRGKGRYR
PAPPDILAAALAAIEKKQQQAARQQQWVEDMVAGRLPEDIAAMAEALVVRPDKNTMQWKA
VESACSRLHKSPDRLLLDLGAFPHALALHKRRFLAQYFPRGTGFPEVQIPALERELPLAD
AEIYSVDDVTTTEIDDALSVSPLPDGKVRVGIHVAAPGLAVTRGGELDKLARARLSTVYM
PGDKIPMQPDSVIQAFSLDAGREVPALSLYVTADPDTGEILESESRVERIVVRENLRHNL
LDDVVTEATLDDPHASLPYGEWLRPLWRLARALSAKRDEVRGKPENNSRVEYSYYVDGDP
DNPDTPVRLVPRKRNAPLDRMVAEYMILANNLWGGLLAQHGVPGIYRSQQAGRVRMSTQA
LPHEAIGVPQYAWSTSPLRRYVDLVNQWQLIAAVDNGVSARLVAPFKPRDADLFAIIGAF
DAQYAAWSDFQNTMERYWCLRWLAQQGITRTTASVLRDDLVRLNNAPLVTRVGGLPALAR
GTQVEIDLLDRDELTLEVECRFVGELPAAAEESEAETE
NT seq 1917 nt NT seq  +upstreamnt  +downstreamnt
atgcacgtgttttacgaagacgacggccagttcaaggccggacatatcatttccgaaacg
gacgccagcctgcaggtggaatccgaatcgggcaaacgcagcaagatcaagcgggccaac
gcgatcttcaccttttcaacgcccgagccggtggagctgctgcgccaggccgaagcggcg
gccgaagacatcgatctgcaattcctgtgggaatgcgctccgcaggaggaattcgattcg
ccggcgctggcggccgactactacggccatgcgccctccccgaccgaacaggcggcgctg
ctcatgcggctgcacggcgcgccggcgtatttccatcggcgcggcaaggggcgctatcgc
ccggccccgccggatatcctggccgccgcgctggccgccatcgagaaaaagcagcagcag
gccgcccgccaacagcaatgggtggaagacatggtggcgggccgcctgccggaggacatc
gctgccatggccgaagcgctggtggtgcgtcccgacaagaacaccatgcaatggaaggcc
gtggaaagcgcgtgttcgcggctgcacaaaagcccggaccgcctgctgctggacctgggt
gccttcccgcatgcgctggccttgcacaagcgccgcttcctggcgcagtactttccccgc
ggcacgggcttccccgaagtacaaatccccgcgctggagcgcgagctgccgctggcggac
gccgagatctattcggtggacgacgtgacgacgacggagatcgacgatgcgctgtcggtg
tccccgctacccgacggcaaggttcgcgtgggcatccacgtggccgcgcccggcctggcc
gtcacgcgtggcggtgagctggacaagctggcgcgcgcacggctgtccacggtctacatg
ccgggggacaagatccccatgcagcctgactcggtgatccaggctttttcgctggacgcc
ggccgcgaagtcccggccttgtccttatatgtcaccgcggacccggatacgggcgaaatc
ctggaatccgaaagccgggtcgaacgcatcgtggtgcgcgagaacctgcgccacaacctg
ctggacgacgtggtcacggaagccacgctggacgatccgcacgcgtccctgccctacggc
gaatggctgcgcccgctgtggcggctggcgcgggcgctgtcggcgaagcgcgacgaagtg
cgcggcaagcccgaaaacaacagccgcgtggaatacagctattacgtggacggcgatccg
gacaatccagatacgccggtgcgcctggtgccgcgcaagcgcaacgccccgctggaccgc
atggtcgccgaatacatgatcctggccaacaatctgtggggcggcctgctggcgcagcac
ggcgtgccgggcatctaccgatcgcagcaggccggccgggtgcggatgagcacccaggcg
ctgccgcatgaagccatcggcgtgccgcaatatgcgtggagcacctccccgctgcgccgc
tatgtcgacctggtcaaccagtggcagctgatcgcggcggtggacaacggcgtgtcggcg
cgcctggttgctcccttcaagccgcgcgacgcggacctgttcgccatcatcggtgcgttc
gacgcgcaatacgccgcctggagtgacttccagaacaccatggaacgatactggtgcctg
cgctggctggcgcagcagggcatcacgcgcaccacggcgagcgtgctgcgcgacgacctg
gtgcggctgaacaatgcgccgctggtcacccgcgtcggcggcctgcccgcgctggcacgc
ggcacgcaggtggagatcgacctgctggaccgcgacgaactgacgctggaggtggaatgc
cgcttcgtcggcgaactgccggcggcggccgaggaaagcgaggccgagaccgaataa

DBGET integrated database retrieval system