KEGG   Bordetella sp. H567: AKI39_09955Help
Entry
AKI39_09955       CDS       T04979                                 

Definition
(GenBank) FAD-dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
boh  Bordetella sp. H567
Pathway
boh00564  Glycerophospholipid metabolism
boh01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:boh00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    AKI39_09955
Enzymes [BR:boh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     AKI39_09955
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored HI0933_like GIDA Pyr_redox_2 NAD_binding_8 FAD_binding_3 Thi4 Pyr_redox Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: AOB30943
UniProt: A0A1B2R1R7
LinkDB All DBs
Position
complement(2198558..2200156)
Genome map
AA seq 532 aa AA seqDB search
MTTSRAVAPPSRDRLLTQLDSAQPWDVIVIGGGATGLGTAVDAAARGYRTLLVEAADFAK
GTSSRATKLVHGGVRYLAQGNIGLVREALHERGLLGRNAPHVVWPLGFLVPAYNLLDQPF
YGIGLKMYDVLAGRLNLKPSRLLSRSQMLADAPTLAPDVGGHRLRGGVLYYDGQFDDARL
ATTLMRTLFDLGGVAVNYMAVTGLNQSNGRVDGVTARDVLSGTAFVLHAKCVINATGVWV
DEIRRMEDRSAMGIVAPSQGVHLTLPRDFLPGDKAVLIPKTDDGRVLFVVPWNGHTIVGT
TDAPRADLPLEPAASREDVDFILSTAGRYLSRKPTRADVTSVWSGLRPLVKASGVGATKT
LSREHTLLVSPTGLITVTGGKWTTYRRMAQDVMDLAAREHILPFAPCRTENLPLHGAAGA
PAGLARPGTPDAYYGSDLPQLRALPGADLMLVPASGLSEAHVRFAARFELARSAEDVLAR
RNRALFLDSAAALRAAPDVARILAEELGHDAAWQRRTVADFAHTARQYQLTA
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgactacctcccgcgccgttgcgcccccctcccgcgatcgcctgttgacacagctcgat
tccgcccagccctgggatgtcatcgtcatcggcggtggcgccacggggctggggaccgcg
gtggacgccgccgcgcgcggctaccgcaccctgctggtcgaagccgcggatttcgccaag
ggcacatccagccgcgccaccaagctggtgcacggcggcgtgcgctacctggcccaaggc
aatatcggcctggtgcgcgaagccctgcatgaacgcggcctgctgggccgcaatgcgccg
cacgtggtgtggccgctgggcttcctggtccccgcgtacaacctgctggaccaaccgttc
tacggtatcggattgaagatgtacgacgtgctggccggccggttgaatctgaaacccagc
cgcctgctgtcgcggtcgcagatgctggccgatgcccccacgttggcgcccgacgtcggc
ggccatcggctgcgcgggggcgtgctctattacgatggccagttcgacgatgcgcggctg
gccacgaccctgatgcgcaccctgttcgacctgggcggcgtggccgtcaactacatggcg
gtcacgggactgaaccagagcaacggacgcgtggacggcgtgacggcgcgcgacgtcctg
agcggcacggccttcgtcctgcatgccaaatgcgtgatcaacgccaccggcgtatgggtg
gacgagatccgccgcatggaagaccgctccgccatgggcatcgtggcacccagccagggc
gtgcacctgacgctgccgcgtgatttcctgcccggcgacaaggccgtcctgattcccaag
accgacgacggccgcgtgctgttcgtcgtgccctggaacggccacaccatcgtcggcacc
accgatgcgccgcgcgcggacctgcccctggagcctgcggccagccgcgaggacgtggac
ttcatcctgtccacggcgggccgctacctgagccgcaagcccacccgcgcggacgtgacc
agcgtgtggagcggcttgcgtccgctggtgaaggccagcggcgtgggggcgaccaagacg
ctgtcgcgcgagcataccctgctggtatccccgaccggcctgatcaccgtcaccggcggc
aaatggaccacctatcggcgcatggcgcaggacgtcatggacctggccgcgcgcgagcac
atcctgcccttcgccccgtgccgcaccgaaaacctgcccttgcacggggccgccggcgca
cccgccggcctggcccggccgggcaccccggacgcctactacggcagcgatcttccgcag
ttgcgtgcgctgccgggcgccgacctgatgctggtgccggccagcggcctgagcgaagcc
cacgtgcgctttgccgcccgcttcgaactggcgcgcagcgccgaggacgtgctcgcgcgc
cgcaatcgcgccctcttcctggacagcgccgccgcgctgcgggcggcgccggacgtggca
cgcatcctcgccgaggaactgggtcacgatgccgcgtggcagcgccgcaccgtggcggac
ttcgcacacacggcgcgccaataccagttgaccgcctag

DBGET integrated database retrieval system