KEGG   Bordetella sp. H567: AKI39_14710Help
Entry
AKI39_14710       CDS       T04979                                 

Definition
(GenBank) alpha-amylase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
boh  Bordetella sp. H567
Pathway
boh00500  Starch and sucrose metabolism
boh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:boh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AKI39_14710
Enzymes [BR:boh01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     AKI39_14710
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     AKI39_14710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C DUF3459 Mak_N_cap hDGE_amylase
Motif
Other DBs
NCBI-ProteinID: AOB31671
UniProt: A0A1B2R3V6
LinkDB All DBs
Position
3279477..3282821
Genome map
AA seq 1114 aa AA seqDB search
MAEDSTVNTPDRDDPLWYKDAVIYQLHIKSFFDANNDGVGDFAGLIEKLDYISQLGVNTI
WLLPFYPSPRRDDGYDIADYRGVHPDYGALPDVRKFIRAAHARGLRVITELVVNHTSDQH
PWFQRARRAKPGSAARNYYVWSDNDQAYAGTRIIFLDTEKSNWTWDPVAGAYFWHRFYSH
QPDLNYDNPQVLREVLAVMRYWLDMGVDGLRLDAVPYLVEREGTNNENLPETHAVLKTIR
AQLDAEYSGRLLLAEANQWPEDAQEYFGKGDECHMSFHFPLMPRMYMAIAREDRFPITDI
MRQTPDIPDNCQWAIFLRNHDELTLEMVTSSERDYLWDVYAADRRARLNLGIRRRLAPLM
ERDRRRIELMNSLLFSMPGTPVIYYGDELGMGDNVHLGDRDGVRTPMQWSPDRNGGFSRA
DPERLPLPALMGPLYGYEAVNVEAQQRDPHSLLNWTRRMLATRRQTRAFGRGTLRFLFPG
NRKILAYLREYEDTTILCVANLSRAPQPVELDLSTLNGRVPVELLGGTPFPAIGELPYLL
TLPPYGFYWFELSAVAAPPSWHATHPEQMPEYYTLVLRGRTGYELTEGAVRSLRQDVLPL
YLTRQRWFPKDRKVNFAQAAYAVQLKDTKYECFIAELEMDFDGKPARFLLPVALIWSETL
PPMAQQYALARVRRAAEMGMLTDAYTLPSFVHALVRGLQQRLELPVPRAHPPCVLHFRGE
PGLDELDLAEDAEVTWFTGEQSNSSMTIGGMAMLKLIRHVVPGVHPEAEMTRRLTQAGYA
NSAQLLGEIVRVDEDGRPHTLALMHTVITNQGDAWAWTLEYLKRTLEAAALTAESVEDYD
EDLKGYTAFACAIGRRLGELHATLAQPTDDPAFAPHKATAADARKRAADVIAMLDRGLKL
LKDNIGRLESACATKAEGLVAQRDELVDAIKTLAQHEIGTLHIRIHGDFHLGQVLVAQSD
AYIIDFEGEPARTLEERRAKSSAARDVAGLLRSFDYAAATVANGFGDVEAAGTEVQPAET
VLRHRRRDLIVRFRDIADKAFLSAYHEIARNAEPRWMDESQEDALIDLALIEKAAYEIAY
EAAHRPDWVSIPLNGLYALANRLLSTETASGPAE
NT seq 3345 nt NT seq  +upstreamnt  +downstreamnt
atggccgaagacagcaccgtcaacactcccgaccgcgatgatccgctctggtacaaggat
gcggtcatctatcagttgcatatcaagtctttcttcgatgccaacaacgatggtgtcggc
gatttcgccgggctgatcgaaaagctggactacatctcgcagcttggcgtcaacaccatc
tggctgttgcccttctacccgtcgccgcggcgtgacgacggctacgacatcgccgactat
cgcggcgtgcatccggactacggcgccctgcccgacgtgcgcaagttcatccgagccgcg
catgcgcgcggcctgcgcgtcatcaccgaactcgtggtgaaccacacgtcggatcagcat
ccgtggttccagcgggcgcggcgggccaaacccggttcggccgcgcgcaattactacgta
tggtcggacaacgaccaggcctacgccggcacccgcatcattttcctggatacggaaaaa
tccaactggacttgggacccggtggctggcgcgtacttctggcatcgcttctattcgcac
cagcccgacctgaactacgacaaccctcaggtgctcagggaagtgctggcggtgatgcgc
tattggctggacatgggcgtggacgggctgcgcctggacgcggtgccctacctggtcgaa
cgcgaaggcacgaacaacgagaacctgccggaaacacacgcggtgctcaagaccatccgc
gcgcagctggacgcggaatactcggggcgcctgctgctggccgaagccaaccagtggccc
gaggacgcgcaggaatacttcggcaagggcgatgaatgccatatgtccttccacttcccg
ctgatgccgcgcatgtacatggccatcgcgcgggaagaccgctttcccatcacggacatc
atgcggcagacgccggatattccggacaactgccaatgggccatcttcctgcgcaatcac
gatgaactgacgctggaaatggtgaccagcagcgaacgggactacctatgggacgtgtac
gcggccgatcgccgcgcgcgcttgaacctgggcatccgacgccgcctggcaccgctgatg
gaacgcgaccgccgccgcatcgagctgatgaacagcctgctgttctccatgccgggcacg
ccggtcatctattacggcgacgaactgggcatgggcgataacgtgcacctgggcgaccgc
gacggcgtgcgtacgcccatgcaatggtcgcccgaccgcaacggcggcttttcgcgcgcc
gatccggaacggctacccctgcccgcgctgatgggaccgctgtacggctacgaagccgtc
aatgtcgaggcgcagcagcgcgatccgcattcgctgctgaattggacgcgccgcatgttg
gccacgcgccgccagacccgcgccttcggccgcggcacgctgcgcttcctgttcccgggc
aaccgcaagatcctggcttacctgcgcgagtacgaagacaccaccatcctgtgcgtggcc
aacctgtcgcgcgcgccgcagcccgtggagctggacctgtccacccttaacgggcgcgtg
ccggtggagctcttgggcggcacgcccttccccgccatcggggaactgccctatctgctg
accctgcctccctacggtttctactggtttgaactgagcgcggtggccgcaccgccgtcc
tggcacgccacgcatccggaacagatgccggagtactacaccctggtgctgcgcgggcgc
acgggctacgagttgaccgaaggcgcggtgcgctcgctgcgccaggacgtgctgccgctg
tacctgacgcgccagcgctggttccccaaggaccgcaaggtcaacttcgcgcaggccgcc
tacgccgtgcagttgaaggacacgaaatacgaatgcttcatcgccgaactggagatggac
ttcgacggcaagcccgcccgcttcctgctgcccgtggccttgatctggagcgaaacgctg
ccgcccatggcgcagcagtatgcgctggcccgcgtgcggcgcgcggccgaaatggggatg
ctgaccgacgcctatacgctgccttctttcgtccacgcgctggtgcgcggactacagcag
cggctggaattgccggtgccgcgcgcccatccgccctgcgtgctgcacttccgtggcgaa
cccgggctggacgaactggacctggccgaggacgccgaagtgacgtggttcacaggcgaa
cagtccaacagctccatgaccatcggcggcatggcgatgctcaagctgatccgccatgtc
gtccccggcgtgcatcccgaagccgagatgacgcgccggctcacgcaggccggctacgcc
aacagcgcgcagctgctgggcgagatcgtgcgcgtcgacgaggacggcaggccgcacacg
ctggccctgatgcataccgtcatcaccaaccagggcgacgcctgggcctggacgctggaa
tacctgaagcgaacgctggaggccgccgccctgaccgcggaaagcgtcgaagactacgac
gaggacctaaagggctacaccgccttcgcctgcgccatcggccggcgtctgggcgaactg
cacgcgaccctggcccagcctaccgacgaccccgcgttcgccccgcacaaggccaccgcc
gcggacgcccgcaagcgcgccgccgatgtcatcgcgatgctggaccgcggcctgaagctg
ttgaaggacaacatcggccgcctggaatccgcctgcgccaccaaggcggagggcctggtc
gcgcagcgcgacgaactggtggacgccatcaaaacactggcgcagcatgagatcggcacg
ctgcatatccgcatccacggcgacttccacctgggccaggtgctggtggcgcaaagcgac
gcctacattatcgacttcgagggtgaaccggcacgcacgctggaagaacgccgcgccaag
agcagcgcggcccgcgacgtcgcgggcctgctgcgctccttcgactacgcggccgcgact
gttgccaacggctttggcgatgtggaggccgccggcacggaggtacagccggccgagacc
gtgttgcgccatcgccgccgcgacctgatcgtgcgcttccgcgatatcgccgacaaagcc
ttcctgtccgcgtatcacgagatcgcgcgcaacgccgagccgcgctggatggacgaaagc
caggaagacgcgttgatcgacctggccctgatcgaaaaagcagcctacgaaatcgcctat
gaggcagcgcatcggccggactgggtcagcatcccgctgaacggcctgtacgcgctggcc
aaccgcctgctgtcgaccgaaaccgcctccgggcccgctgaatag

DBGET integrated database retrieval system