KEGG   Bordetella sp. H567: AKI39_14915
Entry
AKI39_14915       CDS       T04979                                 

Definition
(GenBank) ABC transporter substrate-binding protein
  KO
K17321  glycerol transport system substrate-binding protein
Organism
boh  Bordetella sp. H567
Pathway
boh02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:boh00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    AKI39_14915
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:boh02000]
    AKI39_14915
Transporters [BR:boh02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Glycerol transporter
    AKI39_14915
SSDB
Motif
Pfam: SBP_bac_8
Other DBs
NCBI-ProteinID: AOB31704
UniProt: A0A1B2R404
LinkDB
Position
complement(3332939..3334669)
AA seq 576 aa
MKVRMHAVAAAIALIGSPGAWAGEPEAQKWIDTEFQPSTLSKDQQMAEMKWFIDAAAKLK
AKGINEVNVVSETITTHEYESKTLARAFAEITGIKVNHDIIQEGDVVEKLQTSMQSGKSI
YDGWISDSDLIGTHYRYGAVLPLSDYMNGSGKEYTNPGLDLKDFIGTRFTTAPDGKLYQL
PDQQFANLYWFRADWFARKDLQDKFKAKYGYELGVPTNWSAYEDIADFFTNDVKELDGKR
VYGHMDYGKKDPSLGWRFTDAWLSMAGTADKGLPNGMPVDEWGIRVADDKCTPVGASVER
GGATNSPAAVYALTKYVDWMKKYAPQQATGMTFSESGPVPAQGQIAQQIFWYTAFTADMT
KKGLPVVNDDGTPKWRMAPSPYGPYWKDGMQNGYQDVGSWTFFKSTDPNRMAAAWLYAQF
VTSKTVSLKKSITGLTFIRDSDIHSDFFTKNANNYGGLIEFYRSPARVAWTPTGTNVPDY
PKLAQLWWNNIATAVTGEKTPQQAMDSLANEMDQVMARLQRAGMAQCAPKLNARSDPSKW
LSDQHAPWKKLANEKPKGETIAYDKLLQAWKEGKVR
NT seq 1731 nt   +upstreamnt  +downstreamnt
atgaaagtgcgcatgcatgccgtggcagccgccatcgccctgatcggatcgccgggcgcc
tgggccggggaacccgaggcgcagaaatggatcgatacggagttccagccgtcgacgctc
tccaaggaccagcagatggccgagatgaaatggttcatcgacgcggcagccaagctgaag
gcgaagggcatcaatgaagtcaacgtggtgtcggagaccatcacgacacacgaatacgaa
tccaagacgctggcgcgggcgttcgccgagatcaccggcatcaaggtgaaccacgacatc
atccaggaaggcgacgtggtcgagaagctgcagacgtcgatgcagtcgggcaaatccatc
tacgacgggtggatctccgattccgacctgatcggcacgcattaccgctacggcgccgtc
ctgccgctatccgactacatgaacggctcgggcaaggaatataccaaccccggcctggac
ctgaaggatttcatcggtacgcgctttaccaccgcgccggacggcaagctgtaccaattg
ccggatcagcagttcgccaacctgtattggttccgcgccgactggttcgcgcgcaaggat
ctgcaggacaagttcaaggccaagtatggctatgaactcggcgtgcccaccaattggtcg
gcctacgaggacatcgcggatttcttcaccaatgacgtcaaggagctcgatggcaagcgc
gtgtacggccacatggactacggcaagaaggacccgtcgctgggctggcgctttaccgat
gcctggctgtcgatggccggcacggcggacaagggattgcccaacggcatgcccgtggac
gaatggggcatacgggtggcggacgacaagtgcacgccggttggcgcctcggtggagcgc
ggcggcgcgaccaacagcccggccgcggtctatgccctgacgaaatacgtggattggatg
aagaagtacgcgccgcagcaagccaccggcatgaccttttccgagtccggtcccgtgccc
gcgcagggccagatcgcgcagcagatattctggtacacggccttcacggcggacatgacg
aagaagggcctgcccgtggtgaatgacgacggcacgcccaaatggcgcatggcaccttcc
ccgtatggaccgtactggaaggacggcatgcagaacggctaccaggatgtggggtcatgg
actttcttcaagtccacggatcccaaccgtatggccgccgcctggctgtatgcgcagttc
gtgacgtccaagacggtatcgctgaagaaatccatcacggggctgacctttatccgcgac
agcgacatacacagcgacttctttaccaagaacgccaacaactatggcggactgatcgag
ttctaccgcagtccggcgcgcgtggcatggacgccaaccgggaccaacgtgccggactat
cccaagctggcgcagctctggtggaacaacatcgccacggccgtgacgggcgaaaaaacg
ccgcagcaggccatggacagcctggccaatgaaatggaccaggtcatggcacggctgcag
cgcgccgggatggcgcagtgcgcgcccaagctgaacgcacgcagcgatccgtcgaagtgg
ttatcggaccagcatgcgccgtggaagaagctggccaacgagaagcccaagggcgaaacc
attgcctacgacaagctgctgcaggcgtggaaggagggcaaggtgcggtag

DBGET integrated database retrieval system