KEGG   Bordetella sp. H567: AKI39_16455Help
Entry
AKI39_16455       CDS       T04979                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
boh  Bordetella sp. H567
Pathway
boh00473  D-Alanine metabolism
boh01100  Metabolic pathways
boh01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:boh00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    AKI39_16455
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    AKI39_16455
Enzymes [BR:boh01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     AKI39_16455
Peptidoglycan biosynthesis and degradation proteins [BR:boh01011]
 Precursor biosynthesis
  Racemase
   AKI39_16455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C AFOR_C
Motif
Other DBs
NCBI-ProteinID: AOB31958
UniProt: A0A1B2R560
LinkDB All DBs
Position
complement(3670080..3671225)
Genome map
AA seq 381 aa AA seqDB search
MPRPISVTISVSALAHNLAVVRQHLHQAAASASAADGTQWAPPAIWAVIKAHSYGHGTPQ
GVQGFAQADGLAMLDLAEALECRESGFSRPILLLEGFFEPGDLELAEQYRLTSVVHCREQ
LDMLARARPARALDVFVKLNSGMNRLGFAPDAYGAAHARALELQQQGILGSVGRMTHFAN
ADAPGGVARQLEVFERVTGGLPGPVSISNSAATLRYPEIALARPGTESWVRPGICLYGAS
PFADADAASFGLKPAMSLRSRIIATQQLRAGDAVGYGSLYTADAPTRIGVVACGYADGYP
RHAGTGTPIVVGGIRTRVLGRVSMDMLAVDLTPVPDAGIGTPVSLWGADGPSVDEVAQAA
GTIGYELLCALATRVPVRTTA
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgccacgaccgatttccgtcactatttccgtctccgccctggcccacaaccttgccgtc
gtccgccagcatcttcaccaggccgccgcgtcggcatccgcggcggacggcacgcaatgg
gcaccgcccgccatctgggccgtgatcaaggcgcacagctacggccatggcacgccgcaa
ggcgtgcaagggttcgcgcaggccgacggcctagccatgctggacctggcggaagccctg
gagtgccgcgaatccggcttctcgcgccccatcctgctgctggaaggctttttcgaaccc
ggcgatctggagctggccgagcaataccgcctgacctcggtcgtgcattgccgcgaacag
ctggacatgctggcgcgtgcccggcccgcgcgcgccctggacgtgttcgtcaagctgaac
agcgggatgaaccggctgggcttcgccccggacgcctatggcgccgcgcatgcccgggcg
ctggaattgcagcaacagggcatcctgggcagcgtcgggcgcatgacccatttcgccaac
gccgacgcgcctggcggcgtggcgcgccagctggaggtattcgagcgcgtcacgggcggg
ctgcccggtccggtgagcatatcgaattcggccgccacgctgcgctatccggagatcgcc
ctggcgcgtcccggcacggaaagctgggtgcgtcccggcatctgcctgtatggcgcatcg
ccgttcgccgatgccgacgccgcctccttcggcctgaagccggcgatgtcgctgcgttcg
cgcatcattgccacgcagcagctgcgtgccggcgatgccgtgggatatggcagcctctat
acggcggatgcgccgacgcggatcggcgttgtggcctgtggctatgcggacggctatcct
cgtcacgccggtaccggcacaccgatcgtggtaggggggatacgcacccgcgtcctgggg
cgggtttccatggacatgctggccgtggacctcacacccgtgccggacgccggcatcggc
acgccggtttccctgtggggggccgacggcccttcagtggacgaagtggcgcaggcggcc
ggcaccatcggctacgaactgctgtgcgccttggccacccgcgtgccggtgcgcacgaca
gcctga

DBGET integrated database retrieval system