KEGG   Bordetella sp. H567: AKI39_16855Help
Entry
AKI39_16855       CDS       T04979                                 

Definition
(GenBank) amidase
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
boh  Bordetella sp. H567
Pathway
boh00970  Aminoacyl-tRNA biosynthesis
boh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:boh00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    AKI39_16855
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:boh03029]
    AKI39_16855
Enzymes [BR:boh01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     AKI39_16855
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     AKI39_16855
Mitochondrial biogenesis [BR:boh03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    AKI39_16855
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase DUF2875
Motif
Other DBs
NCBI-ProteinID: AOB32016
UniProt: A0A1B2R515
LinkDB All DBs
Position
complement(3755929..3757248)
Genome map
AA seq 439 aa AA seqDB search
MQTIKQLQGDLQAGRTTSEKLVEQALAAIASYRQAGGAAYLHVDAEAALQAARASDAARR
AGNAPSPIAGLPVSIKDLFDVRGQVTAAGSRALASSAPAAEDAVAVARLRAAGAVLLGRT
NMSEFAFSGLGLNPHHGTPRAPFDEARVAGGSTSGGAVSVAKGMAVATLGTDTGGSIRIP
AAFCGLTGFKPTSHRVSLRGAVPLSRTLDSAGPLANSVDCCVILDRILSGAVLDARPASL
KGLRLYVTRDFVFDGIDPAVAAAFESALSRLSARGAQIVPFDFPELQQLPTINSGGGFTA
AEAWHWHRDLLAAKAQEYDPLVAMRIRRGEKQSAADYITLIDHRARLMAAAAERLRDADA
WLMPTVAVLPPRVEDLQTEEAFFATNALVLRNTSVINFLDGCGVSLPTGQPGIGLAVCGL
QGTDARILQVAGAVEPALG
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgcagaccatcaagcaattgcagggcgacctgcaggcggggcggaccaccagcgagaag
ctggtggagcaggccctggccgccatcgcgtcgtaccgccaggcgggcggcgcggcttac
ctccatgtggacgcggaggcagcgctgcaggcggcacgcgccagcgatgccgcccgtcgc
gcgggtaacgcaccgtcgcccatcgccggtttgcctgtctcgatcaaggacttgttcgat
gtgcgtgggcaggtgaccgcagccggttcgcgcgcgctggcctcgtccgcgcccgccgcg
gaggacgccgtcgccgtggcgcggctgcgcgccgccggcgcggtgctgctgggccgcacc
aacatgagcgagttcgccttctccggcctgggcctgaatccgcaccatggcacgccgcgc
gcgcccttcgacgaagcccgcgttgccggcggttcgacttccggcggcgcggtgagcgtg
gccaagggcatggccgtggccacgctgggcacggataccggcggttctatccgcatcccg
gcggcgttctgcggcttgaccggtttcaagccgacgtcgcatcgcgtttcgctgcgaggc
gccgtgccgctgtcgcgcacgctggattcggccgggccgctggccaattccgtggactgc
tgcgtgatcctcgatcgcatcctgagcggcgcagtgctggatgcgcggcccgcatccctg
aagggattgcgcctgtacgtcacgcgcgacttcgtcttcgacggaatagacccagccgtg
gcggccgccttcgagtcggccctgtcgcgcttgtccgcgcgcggcgcgcagatcgtaccc
ttcgactttccggaattgcagcagttgccgaccatcaacagcggcggcggctttacggcg
gccgaggcctggcactggcaccgggacttgctggcggccaaggcgcaggaatatgaccca
ctggtcgccatgcgcatccgccgcggtgagaagcaatcggcggccgactacatcacgctg
atcgaccatcgtgcccgcctgatggcggccgcggccgagcgcttgcgcgacgcggatgcc
tggctcatgcccaccgtggccgtgctgccgccgcgcgtcgaggacctgcaaaccgaagag
gccttcttcgcaaccaacgcgctggtgctgcgcaataccagcgtgatcaatttcctggac
ggctgcggcgtatcgctgccgaccgggcagccgggtatcggcctggcggtctgcggactg
caaggcacggacgcccggatcctgcaggtggcgggcgcggtcgagcccgccttgggctga

DBGET integrated database retrieval system