KEGG   Bordetella sp. H567: AKI39_17250Help
Entry
AKI39_17250       CDS       T04979                                 

Definition
(GenBank) phospho-2-dehydro-3-deoxyheptonate aldolase
  KO
K01626  3-deoxy-7-phosphoheptulonate synthase [EC:2.5.1.54]
Organism
boh  Bordetella sp. H567
Pathway
boh00400  Phenylalanine, tyrosine and tryptophan biosynthesis
boh01100  Metabolic pathways
boh01110  Biosynthesis of secondary metabolites
boh01130  Biosynthesis of antibiotics
boh01230  Biosynthesis of amino acids
boh02024  Quorum sensing
Module
boh_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:boh00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AKI39_17250
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    AKI39_17250
Enzymes [BR:boh01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.54  3-deoxy-7-phosphoheptulonate synthase
     AKI39_17250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAHP_synth_1
Motif
Other DBs
NCBI-ProteinID: AOB32080
UniProt: A0A1B2R532
LinkDB All DBs
Position
3833601..3834725
Genome map
AA seq 374 aa AA seqDB search
MNRLDDPLHDREVGSADSTLDTTRIDDVRIGAVRPLISPALLLDELPVSPAIQDLVERTR
ASIADVLHARDDRLVVVVGPCSIHDHDQAMDYARLLKSAADELNEDLLIVMRVYFEKPRT
TVGWKGYINDPRLDGSYRINEGLRRARELLLDIAGLGLPTGTEFLDLLSPQFIADLIAWG
AIGARTTESQSHRQLSSGLSCPLGFKNGTDGGVQIAADAIVAARASHAFMGMTKMGMAAI
FETRGNDDTHVILRGGKQGTNYDAASIAACCDILQRAGLREQVMVDCSHANSNKSHSRQI
DVARDVGGQIAGGDRRIVGVMIESHLEEGRQDLKPGVALRRGVSITDACLGWAQTEPVLR
QLAEAVRQRRAAGR
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
ttgaaccgcctggatgaccctttacacgaccgtgaagtcggcagtgccgattccaccctg
gataccacccgcatcgacgacgtgcgcatcggcgccgtgcgcccgctgatttctcccgcg
ctgctgctggacgaactgccggtttcgccggcgatacaggacctggtggagcgaacccgt
gcgtcgatcgccgacgtgctgcacgcgcgcgacgaccggctcgtggtggtcgttggtccc
tgctccatccacgatcacgaccaggcgatggattacgcacggctgctgaaatcggccgcc
gacgaattgaacgaagacctgctgatcgtgatgcgggtgtatttcgagaagccgcgcacc
acggtaggctggaaaggctacatcaacgatccgcgcctggacggcagctaccgcatcaac
gaagggctgcggcgcgcacgcgagctgttgctggacatcgccggcctgggcttgcccacg
ggcacggagttcctggacctgctcagcccgcagttcatcgccgacctgatcgcctggggc
gccataggcgcgcgcacgacggaaagccagagccaccgccagctctcgtccggcctgagc
tgtcccctgggtttcaagaacggaacggacggtggcgtgcagatcgcggcggacgccatc
gtcgcggcgcgcgccagccatgccttcatgggcatgaccaagatgggcatggcggcgatt
ttcgagacgcgcggcaatgacgatacccacgtcatcctgcgcggcggcaagcaagggacc
aactacgacgccgccagtatcgcggcgtgctgcgacatcctgcagcgtgccggcctgcgc
gaacaagtcatggtggattgctcgcacgccaactcgaacaagtcgcacagccggcagatc
gacgtggcccgggacgtcggcggacagatcgccggtggcgaccggcgcatcgtcggcgtg
atgatcgaaagccatctcgaagagggccgccaggacctgaagccgggcgtggcgctgcgg
cggggcgtgtccattacggacgcctgcctggggtgggcccagacggaaccggtgttgcgg
caactggcagaggccgtgcggcagcgtcgcgcggcgggccgctga

DBGET integrated database retrieval system