KEGG   Bosea sp. Tri-49: BLM15_01360Help
Entry
BLM15_01360       CDS       T05753                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
boi  Bosea sp. Tri-49
Pathway
boi00473  D-Alanine metabolism
boi00550  Peptidoglycan biosynthesis
boi01100  Metabolic pathways
boi01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:boi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BLM15_01360
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BLM15_01360
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    BLM15_01360
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:boi01011]
    BLM15_01360
Enzymes [BR:boi01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     BLM15_01360
Peptidoglycan biosynthesis and degradation proteins [BR:boi01011]
 Precursor biosynthesis
  Amino acid ligase
   BLM15_01360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_4 CPSase_L_D2 ATP-grasp_3 GARS_A
Motif
Other DBs
NCBI-ProteinID: AZO76397
LinkDB All DBs
Position
266945..267859
Genome map
AA seq 304 aa AA seqDB search
MSKHVAVLMGGWSVEREVSLRSGAACARALESVGYRVTHVEVGRDVAEVLARLKPEVVFN
ALHGRFGEDGTIQGMLEILGIPYTHSGVLASALAIRKDKAKMVVSAAGVPVAHGISVSRF
EAAKRHALPPPYVIKPIDEGSSVGVVIVKKGREHPPQEIARPDWPCGETMLAETFIAGRE
LTCAVMDGKSLGVTEIRAATGEFYDYDAKYAKGGSIHICPAQILPNIYQRIEECALTAHQ
AIGCRGVSRSDFRYDDESDTLVWLEVNTQPGMTETSLVPELAAHAGMNFGELVKWIVEDA
SLNR
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagcatgtcgcagtgctgatgggcgggtggtcggtcgagcgtgaggtcagcctc
cgcagcggcgcggcctgtgcccgggcgctcgaaagcgtcggctaccgcgtcacgcacgtc
gaggtcggccgcgacgtcgccgaggttctggccaggctgaagcccgaggtcgtcttcaac
gccctgcatggccgcttcggcgaggacggcaccatccagggcatgctcgagattctcggc
attccctatacccattctggcgtgctcgcctcggcgctcgccatccgcaaggacaaggcc
aagatggtcgtgtcggcggccggcgtgccggtggcacacggcatcagcgtctcgcgcttc
gaggcggcgaaacggcacgccctgccaccgccctatgtgatcaagccgatcgacgaaggc
tcatctgtcggggtggtgatcgttaagaaaggccgcgagcatccaccccaggagatcgcc
cggccggactggccctgcggcgagaccatgctggccgaaaccttcatcgccggacgcgaa
ctgacctgcgcggtgatggacggcaagtccttgggggtaacggagattcgggcggcgacg
ggtgagttctacgactacgacgccaaatatgccaaaggcggttcaatccacatctgcccg
gctcaaattttaccgaatatttaccagcggatcgaagagtgtgcgttaacggcgcatcaa
gcaatcgggtgccgcggcgtcagccgttcagacttccgctacgacgacgagagcgacacg
ctcgtctggttggaagtcaacacgcagccgggcatgaccgagactagcctggtgcccgaa
ttagccgcccatgcgggcatgaatttcggtgagctcgtcaaatggatcgtggaggacgcc
tccttaaatcggtga

DBGET integrated database retrieval system