KEGG   Bosea sp. Tri-49: BLM15_06515Help
Entry
BLM15_06515       CDS       T05753                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
boi  Bosea sp. Tri-49
Pathway
boi00010  Glycolysis / Gluconeogenesis
boi00020  Citrate cycle (TCA cycle)
boi00620  Pyruvate metabolism
boi01100  Metabolic pathways
boi01110  Biosynthesis of secondary metabolites
boi01120  Microbial metabolism in diverse environments
boi01130  Biosynthesis of antibiotics
boi01200  Carbon metabolism
Module
boi_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:boi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BLM15_06515
   00020 Citrate cycle (TCA cycle)
    BLM15_06515
   00620 Pyruvate metabolism
    BLM15_06515
Enzymes [BR:boi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BLM15_06515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: AZO77300
LinkDB All DBs
Position
complement(1354795..1356147)
Genome map
AA seq 450 aa AA seqDB search
MPTNILMPALSPTMEKGNLAKWLKKEGDKIKSGDIIAEIETDKATMEVEAVDEGILAKIV
VPEGTADVAVNEVIGVIAGEGEDAKSVSAPAKAEAPKPEAAKPEAPAPKAEAKPESTPQV
TAESGFNTGGKTVSGDRPFASPLARRLAKDAGIDLGKVQGSGPHGRIVEKDIEAAKQGGA
AKAAPVPAAGAPAAPKPAAAPLAAGPSDEQTKKLFAPGSYEEIPHDGMRKTIARRLTEAK
QTIPHFYVTLDCELDALLKLRAELNAAAPEKDGKPAYKLSVNDMVIKALALALRAVPDAN
VSWTDGAMLKHKHADVGVAVSIPGGLITPIIRDACHKTLSQISNEMKDMAARAKTRKLKP
EEYQGGTSAVSNLGMFGVKDFAAVINPPHATILAVGAGEPRAVVKNGQLAVATVMSVTLS
TDHRAVDGALGAELLQAFKGYIEKPMAMLV
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgccgaccaacatcctgatgcccgcgctctctcccacgatggagaagggcaatctcgcc
aaatggctgaagaaggaaggcgacaagatcaagtccggcgacatcatcgccgagatcgag
accgacaaggcgaccatggaggtcgaggcagtcgacgagggcatcctcgctaagatcgtc
gtgcctgaaggcaccgccgacgttgccgtcaacgaggtgatcggagtgatcgccggcgaa
ggcgaggacgccaagagcgtctccgcaccggccaaggccgaagcgcctaagcccgaagcc
gccaagccggaagcgcctgcgccgaaggcggaggccaagcctgaatcgacgccgcaggtc
accgccgaatccggcttcaacaccggtggcaaaacggtgtcgggcgatcgccctttcgcc
tcgccgctggcgcgccgcctcgccaaggacgccggcatcgatctcggcaaggtccagggc
tcgggtccacatggccgcatcgtcgagaaggacatcgaggccgccaagcagggcggggct
gccaaggccgcgccggtgccggcggctggcgctcccgcagcgcccaagcccgccgccgcg
ccgctcgcagccggtccctcggacgagcagaccaagaagctgttcgcgccgggctcctat
gaggagattccgcatgacggcatgcgcaagacgatcgcgcgccgcctgaccgaagccaag
cagaccatcccgcatttctacgtcacgctcgattgcgagctcgatgcgctgctcaagctg
cgcgccgagctcaacgccgcggcgccggagaaggacggcaagccggcctacaagctctcg
gtcaacgacatggtgatcaaggcgctggctctggcgctgcgggccgtgcctgacgccaac
gtctcctggaccgacggcgccatgctcaagcacaagcacgccgatgtcggcgtcgccgtc
tcgatcccgggcgggctgatcacgccgatcattcgcgacgcctgccacaagacactgtcg
caaatctccaacgagatgaaggacatggcggcaagggctaagacacgcaagctgaagcca
gaggagtatcagggcggcacctcggcggtctcgaatctcggcatgttcggcgtcaaggac
ttcgccgcggtaatcaatccgccgcatgcgacgatcctagcggtcggcgccggcgagcca
cgcgccgtggtcaagaacggccagctcgcagtcgcgaccgtgatgtcggtgacgctctca
accgaccaccgcgcggtagatggcgcgctcggcgccgagctgctccaggctttcaagggc
tatatcgagaagccgatggcgatgctggtgtag

DBGET integrated database retrieval system