KEGG   Bosea sp. Tri-49: BLM15_07870Help
Entry
BLM15_07870       CDS       T05753                                 

Definition
(GenBank) phosphopyruvate hydratase
  KO
K01689  enolase [EC:4.2.1.11]
Organism
boi  Bosea sp. Tri-49
Pathway
boi00010  Glycolysis / Gluconeogenesis
boi00680  Methane metabolism
boi01100  Metabolic pathways
boi01110  Biosynthesis of secondary metabolites
boi01120  Microbial metabolism in diverse environments
boi01130  Biosynthesis of antibiotics
boi01200  Carbon metabolism
boi01230  Biosynthesis of amino acids
boi03018  RNA degradation
Module
boi_M00002  Glycolysis, core module involving three-carbon compounds
boi_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:boi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BLM15_07870
  09102 Energy metabolism
   00680 Methane metabolism
    BLM15_07870
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    BLM15_07870
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:boi03019]
    BLM15_07870
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:boi04147]
    BLM15_07870
Enzymes [BR:boi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.11  phosphopyruvate hydratase
     BLM15_07870
Messenger RNA biogenesis [BR:boi03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     BLM15_07870
Exosome [BR:boi04147]
 Exosomal proteins
  Proteins found in most exosomes
   BLM15_07870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Enolase_C Enolase_N MR_MLE_C MAAL_C
Motif
Other DBs
NCBI-ProteinID: AZO77540
LinkDB All DBs
Position
1610599..1611882
Genome map
AA seq 427 aa AA seqDB search
MTAIIDIIGRQILDSRGNPTVEVDVVLEDGSMGRAAVPSGASTGAHEAVELRDGDKSRYL
GKGVLKAVEAVNVAIAEAIVAMDAEDQAAIDQAMIELDGTPNKSKLGANAILGVSLAVAK
AAADASGLPLYRYVGGTSARVLPVPMMNIVNGGAHADNPIDFQEFMVMPIGAPSFAEGLR
MGAEIFHTLKKALHDAGHNTNVGDEGGFAPNIKSAEAALDFVMQAVEKAGYKPGEDVALA
LDCAATEFFKDGSYVYEGERKTRDPKAQAKYLAKLVAGYPIVSIEDGMAEDDWEGWKALT
DLVGNKCQLVGDDLFVTNVTRLSRGIKEKTANSILVKVNQIGTLTETLAAVEMAQRAGYT
AVMSHRSGETEDATIADLAIATNCGQIKTGSLARSDRTAKYNQLLRIEEELGAQAIYAGR
SALKALA
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcgatcatcgacatcatcggccgccagatcctcgattcccgcggcaacccgacg
gtcgaggtcgatgtcgtgctcgaagacggctcgatgggccgcgccgcggtgccgtctggc
gcctcgaccggcgcgcatgaggcggtcgagctgcgcgacggcgacaagagccgctatctc
ggcaagggcgtgctgaaggcggtcgaggccgtcaatgtcgcgatcgccgaagcgattgtc
gcgatggacgccgaggaccaggcggcgatcgaccaggcgatgatcgagctcgatggcacg
ccgaacaagagcaagctcggcgccaacgccattctcggtgtctcgctcgccgtggccaag
gcggccgccgatgcgtccggcctgccgctctatcgctatgtcggcggcacctcggcccgc
gtcctgccggtgccgatgatgaacatcgtcaatggcggcgcccatgccgacaacccgatc
gacttccaggaattcatggtgatgccgatcggcgcgccctccttcgccgaggggctgcgc
atgggcgcggaaatcttccacacgctgaagaaggccctgcacgacgccggccacaacacc
aatgtcggcgacgagggcggctttgcccccaacatcaagtcggcggaagcagcgctcgac
ttcgtcatgcaggcggtcgagaaggccggctacaagcccggcgaagacgtcgcgctggcg
ctcgactgcgccgcgaccgagttcttcaaagacggctcctatgtctatgaaggcgaacgc
aaaacccgcgatccgaaggcgcaggccaagtacctcgccaaactggtcgccggctatccg
atcgtctcgatcgaagacggcatggccgaggatgactgggagggctggaaggcgctgacc
gatctcgtcggcaacaagtgccagctggtcggcgacgacctcttcgtcaccaacgtcacc
cgcctgtcgcggggcatcaaggagaagacggccaactcgatcctggtcaaggtcaaccag
atcggcacgctgaccgagaccctggccgccgtcgagatggcgcagcgcgccggctacacc
gccgtgatgtcgcatcgctcgggcgagaccgaggacgcgaccatcgccgacctcgccatc
gcgaccaattgcgggcagatcaagaccggctcccttgcccgctccgaccggacggcgaag
tacaatcagctcttgcgcatcgaggaggagctcggcgcacaggcgatctatgccgggcgc
tcggcgctgaaggctctcgcctga

DBGET integrated database retrieval system