KEGG   Bosea sp. Tri-49: BLM15_16625
Entry
BLM15_16625       CDS       T05753                                 

Definition
(GenBank) hypothetical protein
  KO
K07646  two-component system, OmpR family, sensor histidine kinase KdpD [EC:2.7.13.3]
Organism
boi  Bosea sp. Tri-49
Pathway
boi02020  Two-component system
Brite
KEGG Orthology (KO) [BR:boi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BLM15_16625
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:boi01001]
    BLM15_16625
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:boi02022]
    BLM15_16625
Enzymes [BR:boi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     BLM15_16625
Protein kinases [BR:boi01001]
 Histidine kinases
  OmpR family
   BLM15_16625
Two-component system [BR:boi02022]
 OmpR family
  KdpD-KdpE (potassium transport)
   BLM15_16625
SSDB
Motif
Pfam: HATPase_c DUF4118 HisKA HATPase_c_2 HATPase_c_3
Other DBs
NCBI-ProteinID: AZO79059
LinkDB
Position
complement(3436462..3437991)
AA seq 509 aa
MILRIDPLAYLKAAGLVAVATVPAVILVVLTPLESVSAIYMLPGLVAAVWYGTGPAVAAA
LLGAVMTSLFYPPLFSVMVVRPSQIVDLVISLIVALTIGRLAGQLRAQMLRVREDERRVR
QLYDLSSEIAGAADVAAIYNIVAAHMADAFEREVVLFAASEGQGWHAIRRSAAAVPATAL
IEAARQFAEGRGRPDSPDVSVADLPAGGRWLLCRLGRPGPLQAVLAVAMGSDSHDLSGEI
VASARSILEEGARSLERLGLTRALEERQLRQRTDALRDILMESVSHELRTPLASILGSAS
VLSTAPAISSEPRLSDLSKAIASEAGRLDRRIQNLLDVTRIRAGALQPRFDEVDPADIVN
GALDSTAERLAGRKVTLALARDLPFVRVDPVLVEQALINILENAAKFAPGDAPITISASE
RDGRLIIAVQDEGPGLDQHEAQQIFERFHRGERHADIAGGSGLGLAIAKTFVEANGGSIE
PLSEGPGKGTTMRLWLPLAVLRAGEPDDD
NT seq 1530 nt   +upstreamnt  +downstreamnt
gtgatcttgcgcatcgatcctcttgcctatctgaaggccgctggtctggtcgccgtggcg
acggtgcctgccgtcatcctggtcgtgctgacgccgctggaaagcgtctcggcgatctac
atgctgccgggattggttgcggcggtctggtacggcaccggccccgctgtcgcggccgcc
ctgctcggcgcggtgatgacctcgctgttttacccaccgctcttcagcgtcatggtggtg
cgaccctcgcagatcgtcgacctcgtcatctcgctgatcgtcgccctgacgatcgggcga
cttgccgggcagctgcgcgcccagatgctgcgggtgcgcgaggacgagcggcgcgtgcgc
cagctctacgaccttagcagcgagatcgccggggcagccgatgtcgctgcgatctacaac
atcgtcgccgcccatatggctgatgccttcgagcgcgaggtcgtgttgtttgccgcaagc
gaaggtcagggctggcacgcgatccgccgatcggccgcggccgtgcccgcaactgcgctg
atcgaagcggcgcgccagttcgccgagggtcgcggccgccctgacagtcccgatgtctcg
gtcgccgatctaccggcgggcgggcgttggctgctctgcaggctgggccggccgggtccg
ctccaggcggtcctggcagtcgcgatgggcagcgacagtcatgatctgagcggtgagatc
gtcgccagcgcccgctccatcctggaggagggagcacgctcgctggaacggctggggctg
acacgcgcgctcgaggagcggcagctgcgccaacgcaccgacgcgctgcgcgacatcctc
atggaatcggtctcgcacgaattgcgcacgccgctggcgagcattctcggctctgccagc
gtgctgtcgacggcgccggcgatctcgtccgagccgcgcctgtccgatctgtcgaaagcc
atcgcctcggaagctggccgcctcgaccggcgcatccagaacctgctcgacgttacccgt
attcgcgccggtgccttgcagccgcgcttcgacgaggtggacccggctgatatcgtcaac
ggcgcgctggacagtaccgctgagcggcttgccggtcgcaaggttacgctggcgctggcg
cgcgatctcccctttgtccgggtcgatccggtgctcgtcgagcaggcgctgatcaacatc
ctggagaacgccgccaagttcgcgccgggcgacgcaccaatcaccatcagtgccagcgag
cgcgacggaaggctgatcatcgcggtccaggacgagggtcccgggctcgaccagcatgag
gcgcagcagatcttcgagcgcttccatcgcggcgagcgtcatgccgatattgcgggcgga
agcggtctggggctcgccatcgcgaagactttcgtcgaggcgaatggcggcagcatcgag
ccgctgagtgagggaccgggtaaaggcacgacgatgcggctgtggctgccgcttgcagtg
ttgcgagcaggagaaccggacgatgactga

DBGET integrated database retrieval system