KEGG   Bosea sp. Tri-49: BLM15_18985Help
Entry
BLM15_18985       CDS       T05753                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
boi  Bosea sp. Tri-49
Pathway
boi00564  Glycerophospholipid metabolism
boi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:boi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BLM15_18985
Enzymes [BR:boi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     BLM15_18985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored Pyr_redox_2 NAD_binding_8 FAD_binding_2 3HCDH_N Pyr_redox GIDA Lycopene_cycl AlaDh_PNT_C HI0933_like
Motif
Other DBs
NCBI-ProteinID: AZO79452
LinkDB All DBs
Position
3966723..3968258
Genome map
AA seq 511 aa AA seqDB search
MTAPVFDIAIIGGGVNGCGIARDAAGRGASVVLFEQSDLASATSSASTKLIHGGLRYLEH
YEFRLVREALTEREVMWRAAPHIIRPLRFVLPHHAGLRPWWMLRLGLFLYDHLGGRRLLP
PTRSLDLRRDAAGESLQPRFDRAFEYSDCWVEDARLVVLNARDAAEHGAKILPRTKVIGA
RRQGDVWVVATEAADGTRAETSARVLVNAAGPWVADVLNGIVASNRPAAVRLVQGSHIVV
PRLFEHERCYIFQNADGRIIFAIPYEGDLTLIGTTDKDYDGDPAKVAASEDEIAYLCAAA
SEYFRKPITRGDVVWTYSGVRPLYDDGASKAQEATRDYVLTLDEPAGSAPLLSVFGGKIT
TARRLAEAAVEKLAAAVPALRASPWTAGAHLPGGDFPVEGFEGLVEHICAARPWLERKLA
RRLARAYGTRAETLLEGAKAMADLGRVFGADLTEREVAWLMSQEWAGSAEDVLFRRSKLG
LRFSPEQRRALDEYMAAKVSPAAPLRAEARG
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
gtgacggctccggtgttcgacatcgccattatcggcggcggcgtgaacggctgcggcatt
gcgcgcgatgcggcggggcgtggagcctcggtcgtgctgttcgaacagtcggaccttgcc
agcgcgacctcttcggcctcgaccaagctgatccatggcgggctgcgctatctcgagcat
tacgagttccggctggtgcgcgaagcgctgaccgagcgcgaagtgatgtggcgcgccgcg
ccgcacatcatccgccccctgcgcttcgtgctgccgcatcatgcgggcctgcggccctgg
tggatgctgcggctcggcctcttcctctacgaccatctcggcgggcgccgactgctgccg
ccgacgcgctcgctcgaccttaggcgcgacgctgccggcgaatcgctgcagccacgcttc
gaccgcgccttcgaatattccgattgctgggtcgaggatgcccgcctcgtcgtgctcaac
gctcgcgacgcggccgaacacggcgccaagatcctaccgcggactaaggtcatcggcgcg
cgccgccagggcgatgtctgggtggtcgccacggaagcggcggacgggacccgcgcagag
accagcgcgcgcgtactcgtcaacgccgccggcccctgggtcgccgatgtgctgaacggc
atcgtcgccagcaaccgcccggctgcggtgcgcctggtccagggtagccatatcgtcgtg
ccgcgcctgttcgagcacgagcgctgctacatcttccagaacgccgatggccgcatcatc
ttcgccataccctatgagggcgacctgaccctgatcggcaccaccgacaaggactatgat
ggcgaccccgccaaggtcgccgccagcgaggacgagatcgcctatctctgcgccgcggcg
agcgagtatttccgcaagccgatcacgcgcggggatgtggtctggacctattccggcgtg
cgcccgctctatgacgacggcgccagcaaggctcaggaagcgacgcgcgactacgtgctg
acgctggatgagccggccggctcggcaccgctgctctcggtcttcggcggcaagatcacc
acggcgcgccggctggcggaagctgcggtcgaaaagcttgccgccgccgtgccggcgctg
cgtgcatcgccctggacggccggggcacatctgcccggcggcgatttccccgtcgagggt
ttcgagggattggtcgagcacatctgcgcggcccgcccctggctcgagcgcaagctggcg
cgccggctcgcccgcgcctatggcactcgcgcggaaaccctgctcgaaggcgccaaggcg
atggccgatctcggccgggtcttcggcgccgacctgaccgagcgcgaggtcgcctggctg
atgagccaggaatgggctgggagcgccgaggacgtgctgttccggcgcagcaagctcggc
ctgcgcttttcgcccgagcagcgtcgggcgctcgacgagtacatggcggcgaaagtctcg
cctgctgctccccttcgggcggaggcgcgcggatga

DBGET integrated database retrieval system