KEGG   Bosea sp. Tri-49: BLM15_20925
Entry
BLM15_20925       CDS       T05753                                 

Definition
(GenBank) histidine kinase
  KO
K14980  two-component system, OmpR family, sensor histidine kinase ChvG [EC:2.7.13.3]
Organism
boi  Bosea sp. Tri-49
Pathway
boi02020  Two-component system
Brite
KEGG Orthology (KO) [BR:boi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BLM15_20925
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:boi01001]
    BLM15_20925
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:boi02022]
    BLM15_20925
Enzymes [BR:boi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     BLM15_20925
Protein kinases [BR:boi01001]
 Histidine kinases
  OmpR family
   BLM15_20925
Two-component system [BR:boi02022]
 OmpR family
  ChvG-ChvI (acidity sensing)
   BLM15_20925
SSDB
Motif
Pfam: Stimulus_sens_1 Sensor_TM1 HATPase_c HisKA HAMP HATPase_c_2 HATPase_c_3 DUF2730 HATPase_c_5
Other DBs
NCBI-ProteinID: AZO79785
LinkDB
Position
complement(4368984..4370777)
AA seq 597 aa
MATIEQEGARAGGPRTGLTLRRRAALFGRRVWRAISGRAASSLTRRIVVLNLAGLVALLV
GFLYLNQFREGLIEARVQSLLTQGEIIAGAIAASATVETDTIAIDPDKLLQMQAGESGAI
AEDPLDFSINPEKVAPLLRRLVTPTKTRARIYDKDGMLTLDSRNLYSRGDILRLDLPRIG
ESDEPPLLERTWNLFRNRLGRADVPAYDDFANANGRSYTEVARALAGSPASVVRVNTRGE
TIVSVAVPVQRFRAVRGALLLSTQGGDIDAVIASERYAIFQVFVVAAGVMIVLSVLLAGT
IAEPIRKLADAAQRVRRGVKSREEVPDFSSRHDEIGHLSGSFREMTQALYNRMEAIERFA
ADVAHELKNPLTSLRSAVETLPLAKNDDSRSRLLAVIRHDVKRLDRLITDISEASRLDAE
LARDDAAPLDVAQLAEAVVSVQNQIRREGQPVVELSVDRRGQRPGGDPFRVFGHDSRLGQ
VLVNLIENARSFSPKDKPVRVKLSRVAGDVLIAVEDDGPGIPPHALERIFERFYTDRPES
GFGQNSGLGLSISRQIVEAHRGTIRAENRYTSEQSEGEDQRLGARFIVRLPAAAQPA
NT seq 1794 nt   +upstreamnt  +downstreamnt
atggctacgatcgaacaggaaggggctcgcgctggcgggccgcggacggggctgacgctg
cgccgccgcgccgcgctgttcggtcgccgtgtctggcgcgccatctccggtcgggccgcc
tcgagcctgacccggcgcatcgtcgtcctcaatctcgccggcctcgtcgccctcctcgtc
gggttcctttatctcaaccagttccgcgagggcctgatcgaggcgcgcgtgcagagcctg
ctgacgcagggcgagatcatcgccggggccatcgccgcctccgctacggtcgagaccgac
acgatcgcgatcgatccggacaagctcttgcagatgcaggctggcgagagcggcgccatc
gccgaggaccctctggatttctcgatcaacccggaaaaggtcgccccgcttctgcgtcgg
ctggtgacgccgaccaagacgcgcgcccgcatctacgacaaggacggaatgctgacgctc
gattcgcgcaatctctattcgcgcggcgacattttgcggctcgacctgccgcgcatcggc
gagagtgacgagccgccgctgctcgagcgcacctggaacctgttccgcaaccggctcggc
cgtgccgatgtgccggcctacgacgatttcgccaatgccaacggcagatcctacaccgag
gtcgcccgcgcgctggccggctcgccggccagcgtggtgcgggtcaacacccgcggcgag
acgatcgtctcggtcgccgtgccggtgcagcgcttccgggccgtgcgtggcgcgctgctg
ctctcgacgcaaggcggcgacatcgacgctgtcatcgcgtccgagcgctatgccatcttc
caggtcttcgtggtcgcggccggcgtgatgatcgtgctctcggtgctgcttgccggcacc
atcgccgaaccgatccgcaagctggccgatgcagcccagcgcgtccgccgcggggtcaag
tcgcgcgaggaggtcccggatttctcaagtcgccatgacgaaatcggccatctctccggc
tcgttccgcgagatgacccaggcactgtacaatcgcatggaggcgatcgagcgcttcgcc
gccgatgtcgctcatgaactcaagaacccgctgacctcgctacgcagtgccgtcgagacc
ttgccacttgcaaagaacgacgactcgcgcagccgtctgctcgcggtgatccgccacgat
gtgaaacggctcgatcggttgatcaccgacatctcggaggcgtcgcgcctcgatgccgag
ctcgcacgcgacgatgccgctccgctggacgtggcgcagctcgccgaagcggtcgtctcg
gtccagaaccagattcgccgggaaggccagccggtcgtcgagctttcggtcgaccggcgc
ggccagcggccgggcggcgaccccttccgggtgttcggccacgattcccgcctcggccag
gtcctcgtcaacctgatcgagaacgcccgttccttttcgccgaaggacaagccggtcagg
gtcaagctatcgcgcgtcgccggcgatgtgctgatcgcggtcgaggacgacggtccgggc
attccgccacatgcactcgagcggattttcgagcgcttctacaccgaccggccggagagc
ggctttggccagaattccggcctcggcctctcgatttcacgtcagatcgtcgaggcccat
cgcggtacgatccgggccgagaaccgctacacctcggagcaatcagagggcgaggaccag
cgtctgggtgcccgcttcatcgtgcgtttgccggcggcggcgcagccggcatga

DBGET integrated database retrieval system