KEGG   Bosea sp. Tri-49: BLM15_20930
Entry
BLM15_20930       CDS       T05753                                 

Definition
(GenBank) DNA-binding response regulator
  KO
K14981  two-component system, OmpR family, response regulator ChvI
Organism
boi  Bosea sp. Tri-49
Pathway
boi02020  Two-component system
Brite
KEGG Orthology (KO) [BR:boi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BLM15_20930
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:boi02022]
    BLM15_20930
Two-component system [BR:boi02022]
 OmpR family
  ChvG-ChvI (acidity sensing)
   BLM15_20930
SSDB
Motif
Pfam: Response_reg Trans_reg_C
Other DBs
NCBI-ProteinID: AZO79786
LinkDB
Position
complement(4370842..4371543)
AA seq 233 aa
MPTIALVDDDRNILTSVSIALEAEGYRIQTYTDGASALDGLKQNPPDLAIFDIKMPRMDG
MELLRRLRQKSDLPVIFLTSKDEEIDELFGLKMGADDFIRKPFSQRLLVERVKAILRRAG
GKDASAPARSEDAKALERGLLRMDPERHTCTWKGEPVTLTVTEFLILQSLAQRPGVVKSR
NALMDAAYDDEVYVDDRTIDSHIKRLRKKFNQVDVEFDMIETLYGVGYRFKEG
NT seq 702 nt   +upstreamnt  +downstreamnt
atgccaaccattgcgctggtcgacgacgaccgcaacatcctgacctcggtttcgatcgca
ttggaagccgagggctatcgcatccagacctatacggatggcgcctccgccctcgacggg
ctgaagcagaatccgcccgacctcgccatcttcgacatcaagatgccgcgcatggacggg
atggagctgctgcgccgcctgcgtcaaaaatccgacctgccggtgatcttcctgacttcc
aaggacgaggagatcgacgagctcttcggcctgaagatgggtgccgacgacttcatccgg
aagccgttctcgcagcgcctgctggtcgagcgcgtcaaggcgatcctgcgccgcgccggc
ggcaaggacgcgagcgcgcctgcccgctcggaggacgccaaggcgctggaacgcggcttg
ctgcgcatggatccggagcggcacacctgtacctggaagggcgagccggtgacgctgacc
gtcaccgaattcctgatcctgcagtcgctggcgcagcggccgggcgtggtcaagagccgc
aacgcgctgatggacgcggcctatgacgacgaggtctatgtcgacgatcgcaccatcgac
agccacatcaagcgcctgcgcaaaaaattcaatcaggtcgatgtcgagttcgacatgatc
gagacgctctatggcgtcggctaccgcttcaaggaaggctga

DBGET integrated database retrieval system