KEGG   Bosea sp. Tri-49: BLM15_21265Help
Entry
BLM15_21265       CDS       T05753                                 

Definition
(GenBank) DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
boi  Bosea sp. Tri-49
Pathway
boi03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:boi00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    BLM15_21265
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:boi03400]
    BLM15_21265
Enzymes [BR:boi01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     BLM15_21265
DNA repair and recombination proteins [BR:boi03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     BLM15_21265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: AZO79842
LinkDB All DBs
Position
complement(4434343..4436889)
Genome map
AA seq 848 aa AA seqDB search
MANLDLYRSKRDFSRTREPKGAASRRKAAQAGGAFVFHKHAARRLHYDLRLEHAGVLWSW
AVTRGPSLDPREKRLAVHVEDHPLEYGSFEGTIPEGEYGAGSVVIWDEGKWIPEGDPVRG
MEKGHLAFALEGHKLAGRWHLVRLKPRRGEKRDNWLLIKVDDDFARDDEDILETAPDSVK
SGRSVEEVGEDPGGDVWSTDEKPAKGRKPSVAKPKTAKAKTAKAKATGRSAKTEGEPLPR
FIEPCLATLQDKPPAGEAWLHEVKFDGYRLQARISAGQVKLLTRTGLDWTERFGKTIVDA
FAALPCETALIDGEVVALSENGISSFSALQAALLEDKTANLVFFAFDLLYLDGENLQPEP
LLARKGRLEELLSAAGADAPLRYSEHFIEPGQTMLRHACRMGLEGVISKRAEASYRSGRG
RDWIKSKCTQRQEFVIAGYVPSKASRNQLGSLVLGYHEDDELKPAGRVGTGFTRNSAAAL
KKKLDAITAKASPFRGEAGRERGIVWVKPELVAEIAFGSWTASKTLRHSAFLGLREDKPA
EEVVEEKPAKAKSDKVAKKTARKPATGPETTVTLSNPDKPLWPDIGFTKQDLLDYYASVW
ERMAPFVVERPLSLLRAPDGVGGQVFFQKHAGAGLHKAVSRMKDKDGEELLFIRDFDGLA
ALVQLGTVEVHVWGATIDAVETPDQIIFDLDPDQGVPMERVREGALTVRQRLDELGFESF
LKTSGGKGFHVVLPLKPKADWDEVKGFARDFAKAMEQAQPKLYTATLSKKARKGRIFIDY
LRNGRGSTAIAPFSTRARPGAAVAMPVAWELLEKSLAPDAFKAPEVTKKGPPDDAWAAFF
KPKRSLKR
NT seq 2547 nt NT seq  +upstreamnt  +downstreamnt
atggccaatctcgacctctaccgctcgaaacgcgatttctcccgcacccgcgagccgaaa
ggcgccgccagccgtcggaaggcagcacaagccggcggtgccttcgtattccacaagcac
gccgcccgccgcctgcattacgatctcaggctcgagcatgccggcgtgctctggtcctgg
gcggtgacgcgcgggccgagcctcgacccgagagagaagcgcctcgccgtccatgtcgag
gaccatccgctcgaatacggctccttcgaaggcacgattcctgagggcgagtacggtgcc
ggctcggtcgtcatatgggacgaaggcaaatggattccggaaggcgatcccgttcgcggc
atggagaagggccacctcgccttcgcgctcgaaggccataagctcgccggccgctggcat
ctggtgcgtttgaagccccgccgcggcgagaagcgcgacaactggctgctgatcaaggtc
gacgacgatttcgcccgcgacgacgaggacatcttggaaacggcgccggattcggtgaag
tcgggcaggagcgtcgaggaggtcggcgaggatccgggcggcgacgtctggtcgaccgac
gaaaagcccgcgaaaggccgcaagcccagtgttgccaagcccaagaccgcaaaagctaag
acagcaaaggccaaggctactgggcgttcggcaaagaccgaaggcgagccgctaccgcgc
ttcatcgaaccatgcctcgcgaccctgcaggacaagccaccggccggcgaagcctggctg
cacgaggtcaagttcgacggttaccggctgcaggcgcgaatatccgccggacaggtcaag
ctgctcacccgcaccgggctcgattggaccgaacgcttcggcaaaacgatcgtcgacgcc
ttcgccgcgctgccctgcgagacggcgctgatcgacggtgaagtcgttgcgttgagcgag
aacggcatctcgtccttttccgcgctccaggcagcgctgttggaggacaagaccgcgaac
cttgtcttcttcgccttcgacctgctctatctcgacggtgagaacctgcagcccgagcca
ctgctcgcccgcaagggacggctggaggagctgctgagcgctgcgggagcggatgcgcct
ttgcgttattccgagcatttcatcgagccgggccagaccatgctgcgccatgcctgccgc
atggggctggagggcgtgatctccaagcgcgccgaggcgtcctatcgcagcggccgcggg
cgcgactggatcaagtcgaaatgcacgcagcgccaggaattcgtcatcgccggctatgtc
ccgtccaaggcctcgcgcaaccagctcggctcgctcgttctcggctatcatgaggatgac
gagctgaagcccgccggccgggtcggcaccggcttcacccgcaactcagctgctgcgctg
aagaaaaagctcgatgcgatcaccgcgaaggcctcgcctttccggggcgaagccggacgc
gagcgtggtatcgtctgggtgaagcccgaactcgtcgccgagatcgccttcggctcctgg
acggcctcgaagaccctgcggcactcggccttcctcggtctgcgcgaggacaagccggct
gaggaggtggtcgaggagaagcctgccaaggctaagtcggacaaggtggcgaagaaaacg
gcgcgcaagcctgcaactgggccggagaccaccgtgacgctgagcaatcccgacaagccg
ctctggcccgatatcggcttcaccaagcaggatctgctcgactattacgccagcgtttgg
gagcgcatggccccctttgtggtcgaaagaccgctcagcctgctgcgtgcgccagatggc
gtcggcggccaggtcttcttccagaagcatgccggcgccggcctccataaggcggtctcg
cggatgaaggacaaggatggcgaagagctgctcttcatccgcgatttcgacgggctcgct
gcactcgtccagctcggcacggtcgaagtccatgtctggggcgcgacaatcgacgcggtc
gagacgcccgaccagatcatcttcgatctcgaccccgaccagggcgtgccgatggagcgg
gtgcgcgagggggcactgaccgtgcgccagcgcttggatgagctcggcttcgagagcttc
ctcaagacctccggcggcaagggcttccacgtcgtgctgccgctgaagcccaaggcggat
tgggacgaggtcaagggcttcgcccgcgacttcgccaaggcgatggagcaggcgcagcca
aaactctacaccgcgaccctgtcgaagaaggcgcgcaagggccgcatcttcatcgactat
ctccgcaatggccgcggctcgactgcgatcgcgccgttctcgacaagagcccgtcccggc
gccgccgtcgccatgccggtcgcttgggaactgctggagaagagtctggcgcccgatgcc
ttcaaggcgccggaggttacgaagaagggcccgcccgacgacgcctgggctgcattcttc
aagccgaagcggtcgctgaagcgctga

DBGET integrated database retrieval system