KEGG   Bordetella sp. J329: CBF45_02075Help
Entry
CBF45_02075       CDS       T05850                                 

Definition
(GenBank) cell division protein
  KO
K03587  cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4]
Organism
boj  Bordetella sp. J329
Pathway
boj00550  Peptidoglycan biosynthesis
boj01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:boj00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CBF45_02075
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    CBF45_02075
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:boj01011]
    CBF45_02075
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:boj03036]
    CBF45_02075
Enzymes [BR:boj01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     CBF45_02075
Peptidoglycan biosynthesis and degradation proteins [BR:boj01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   CBF45_02075
Chromosome and associated proteins [BR:boj03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    CBF45_02075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer FANCI_HD1
Motif
Other DBs
NCBI-ProteinID: AZV95346
UniProt: A0A3T0NJD0
LinkDB All DBs
Position
468238..469962
Genome map
AA seq 574 aa AA seqDB search
MRRAPFFNNPVLKSSLPLWRARLVFILLFLGFAVLAGRALFLQGLSTEFLQQQGERRYER
TLTLPAVRGKVTDRHGEVLASSVPARAIWAIPEDAAGASPESLAQLASLLEMNATDISAR
LSDTSRNFVYLKRQVPMDVAEQVQALKVPGVSLQPEMRRYYPERDVAAHLVGFTNLDGRG
QEGVELAFESMLSGKDGSRRVIRDRLGRVIEDVRDIHPPIDGQDIRLSIDMRLQFAVYKA
LQDAMEENKAKGAAAVVLDVRTGEVLALVNLPSYDPNDRTGLRGDMLRNRAVTDTFEPGS
IMKPFTVALALDLKRISTNSTFDTGNGRLVYQGRTISDVSRNGVITPADILRRSSNIGMT
LISEKLSAQEMWTKFTELGFGQAPKIGFPGVAAGSLRPWERWRLIEKATMSYGYGLSVSL
MQVARAFAVFARDGDVVPLSLLQRDEAVTGTQIYTPETARSVRSMLEAAAGEDGARRARV
DGYRVAGKSGTARKIVDGKYSTKHFRSSFVGFAPASDPRLVVAVSIDEPGAGAYYGGRVA
APVFSTIMGHCLRLLGVRPDAPVDGPVAAAGGVR
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atgcggcgcgctccctttttcaataatccggtactcaagagcagcctgcccctgtggcgg
gctcggctcgtttttatcctcctgtttctgggcttcgccgtgctggccgggcgggcgctg
ttcctgcagggcctgtcgaccgaattcctgcagcagcaaggcgaacgccgctacgagcgc
acgctgacgctgcctgcagtgcgcggcaaggtgacggaccggcacggtgaagtgctggcg
tccagcgtaccggcgcgcgccatttgggccattcccgaggacgcggccggggcgtcgccc
gaaagcctggcgcaactggccagcctgctggaaatgaatgccactgacatcagtgcgcgc
ctgagcgataccagccgcaatttcgtttacctgaagcgccaggtgcccatggatgtggcc
gaacaggtccaggcgctgaaggtgcctggcgtgtccctgcagccggaaatgcgccgctac
tatccggagcgcgacgtggcggcccatctggtgggcttcaccaatctggacggccgaggc
caggaaggcgtcgagctggcgttcgaatccatgctgtccggcaaggacggtagccggcgc
gtcatccgtgaccgcctggggcgcgtcatcgaagacgtacgcgacatccacccgccgatt
gatggccaggatattcgcctgtccatcgacatgcgcctgcaattcgccgtttacaaggcg
ctgcaggatgccatggaggaaaacaaggccaagggcgcagccgccgtcgtgctggacgtg
cgcaccggcgaagtgctggcgttggtgaacctgccgtcctacgaccccaatgaccggacc
gggctgcgtggcgacatgctgcgcaaccgggccgtgaccgataccttcgagcccggctcc
atcatgaagccgttcaccgtggcgttggcgctggacctcaagcgtatcagcaccaatagc
accttcgataccggcaatggccgcctggtctaccaggggcgcaccatcagcgacgtgagc
cgcaatggcgtcatcacgccggccgatatcctgcgccgctccagcaacatcggcatgacg
ctgatctcggagaaactgtcggcccaggaaatgtggaccaagttcacggaactgggtttc
ggccaggcgcccaagatcggtttccccggcgtggcggctggcagtctgcgcccctgggag
cgctggcgcctgatcgagaaggccaccatgtcctacggctatggcctgtcggtgtcgctg
atgcaggtagcccgagcgttcgcggtgtttgcgcgcgatggtgatgtcgtgccgctgtcg
ctgctgcaacgcgacgaagccgtcaccggtacgcagatttatacgcctgaaacggcccgc
agcgtgcgcagcatgctggaagctgctgcaggcgaagacggcgcccggcgggcgcgggtc
gatggctaccgcgtggcaggcaagagcggcaccgcccgcaaaatcgtcgacggcaagtac
agcaccaagcatttccgcagttccttcgtcggtttcgcgccggcttccgatccgcgcctg
gtcgtggccgtcagtatcgacgagcccggcgctggcgcttattacggcggccgcgtggcc
gcaccggtattttccaccatcatgggccattgcctgcgtctgctgggcgtgcggccggat
gctcctgtggacggaccggtggcagcagcgggaggcgtgcgatga

DBGET integrated database retrieval system