KEGG   Bordetella sp. J329: CBF45_06810Help
Entry
CBF45_06810       CDS       T05850                                 

Definition
(GenBank) AraC family transcriptional regulator
Organism
boj  Bordetella sp. J329
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AraC_binding_2 HTH_18 HTH_AraC
Motif
Other DBs
NCBI-ProteinID: AZV93463
UniProt: A0A3T0NDX3
LinkDB All DBs
Position
complement(1556608..1557576)
Genome map
AA seq 322 aa AA seqDB search
MQPTAAHPVSQISTNTLPPSQRLDYWESYNASMLVGLKCSAFSDDGLLATQRNLMMGDIR
LAEIQANEHVIERTPQMVRRHPKDSVFASLILESNAFFYQGSSCTQLEPGDLILYDTRHA
YLFGFTGSMRQFLLDTPADWFYQSCSHSSLTRPLHVPGGSGPGRVLNAALRRLAAGTFAE
PASTSADQMHQQAGELLRSLLAGDTGNSSALRATYLQAARSHIDSQLDDHTLDAERVAGA
AGITLRHLNRLLEPEGRTVSQLILERRLDRAASLLRRRDMQRYSIAEISWRCGFSSPAHF
ARTFRARHALTPTQMREAALSG
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgcagccaactgccgcccaccccgtcagccagatatcaaccaataccctgccgcccagc
cagaggctggactattgggagtcctataacgcctccatgctggtcggcctgaaatgttcg
gccttttcggatgatggcctgctggccacccagcgcaacctgatgatgggcgacatccgt
ctggcggagatccaggccaatgaacacgtgatcgagcgcacgccgcagatggtgcgccgc
catcccaaggattcggtcttcgcttcgctgatcctggagagcaacgcctttttctaccag
ggcagcagctgcacgcaactggaaccgggcgacctgatcctgtacgacacacgccatgcc
tacctgttcggcttcaccggcagcatgcgccagttcctgctggatacgcccgcagactgg
ttctatcagtcctgtagccactccagcctcacgcggccgctgcacgtcccgggcggcagc
gggcccggacgcgtgctcaatgcggcgctgcgccgcctggccgccggcaccttcgccgag
cctgccagcaccagtgcagaccagatgcaccagcaggccggagaactgctgcgcagcctg
ctggctggcgacaccggcaacagcagcgcgctgcgcgccacctatctgcaggcggcgcgc
agccatatcgacagccagttggacgatcacaccctggatgcggaacgggtggcgggggcg
gccggcatcacgctgcgccacctgaaccggctgctggaaccggaaggacgcaccgtatcg
caattgatcctggaacggcgcctggaccgcgccgccagcctgctgcgacgccgcgacatg
caacgctacagcatcgcggaaatttcctggcgctgcggcttctccagcccggcgcatttc
gcccgcaccttccgcgcacgccacgcactcacgcccacgcaaatgcgcgaggccgcactg
tccggttag

DBGET integrated database retrieval system