KEGG   Bordetella sp. J329: CBF45_06815Help
Entry
CBF45_06815       CDS       T05850                                 

Definition
(GenBank) 2,4-dihydroxyacetophenone dioxygenase
  KO
K05913  2,4'-dihydroxyacetophenone dioxygenase [EC:1.13.11.41]
Organism
boj  Bordetella sp. J329
Pathway
boj01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:boj00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00363 Bisphenol degradation
    CBF45_06815
Enzymes [BR:boj01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.41  2,4'-dihydroxyacetophenone dioxygenase
     CBF45_06815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cupin_2 Cupin_7 AraC_binding
Motif
Other DBs
NCBI-ProteinID: AZV93464
UniProt: A0A3T0NDY6
LinkDB All DBs
Position
1557840..1558373
Genome map
AA seq 177 aa AA seqDB search
MPELPSNEFWRGLKPIPNCFQPDAKPEVYISNAPTEDERMYVPFTDTVSSRPLWISPSEN
RWCDILMAKEAGLVNRHYHPHEVFAYTISGKWGYLEHDWTAHAGDFVYETPGEGHTLVAY
EHEDPMRAFFIVKGPLIWLDENGEPEGYFDVHSYIDMCRKHYDKVGIGADYVDTLFR
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgcccgagctgccttccaatgaattctggcgcggcctcaagcccattcccaactgtttt
cagccggatgccaagcccgaggtctatatctcgaacgcccccaccgaagacgagcgcatg
tacgtgccgttcacggataccgtctcctcccgcccgctgtggatttccccgtcggaaaat
cgctggtgcgacatcctgatggccaaggaagctggcctggtgaaccgtcactatcatccg
cacgaggtgttcgcctacacgatctcgggcaagtggggctatctggagcatgactggacg
gcgcatgccggcgattttgtctacgaaacgccgggcgagggccatacgctggtcgcctat
gagcatgaagaccccatgcgcgcctttttcatcgttaaggggccgctgatctggctggac
gagaacggcgagccggaaggctatttcgatgtacacagctacatcgacatgtgccgcaag
cattacgacaaggtcggcataggcgccgattacgtcgataccctgttccgctag

DBGET integrated database retrieval system