KEGG   Bordetella sp. J329: CBF45_06825Help
Entry
CBF45_06825       CDS       T05850                                 

Definition
(GenBank) butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
boj  Bordetella sp. J329
Pathway
boj00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:boj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    CBF45_06825
Enzymes [BR:boj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     CBF45_06825
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     CBF45_06825
    1.1.1.-  
     CBF45_06825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 DZR 2-Hacid_dh_C Methyltransf_25
Motif
Other DBs
NCBI-ProteinID: AZV93466
UniProt: A0A3T0NDZ2
LinkDB All DBs
Position
1559757..1560809
Genome map
AA seq 350 aa AA seqDB search
MKAWFWHGARDLRLQETALRPLQRGEVRIEVAYCGICGSDLHEYADGPHSIPVVQPHPLS
GRQAPLIIGHEFCGTVLETAADVTTLRPGARVTIEPEYRCGHCTHCLAGDYNLCVSMGFA
GLMGDGGMAQQAVVPAYMAHELPNEVPFEQAAVAEPAAVALHAVRRSRLRPGDTCVIFGL
GAIGQLLVMMARLQGAGQIIAVDVVPARLALARQLGADLTLDARHDDVLTVALAHTDGAG
APVSFEAAGSQATFDGALQVLCKGGEMVLVGLVPQVRLDSFDLVNRELSITSSVGYRGVY
PDLLAWIAEGSLDLSQVVTRIVALEDAVTDGFEAQLQSRDEIKILVRPCG
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcatggttctggcatggggcgcgtgacctgcgcctgcaggaaacggcgctgcgg
ccattgcagcgcggggaagtgcgcatcgaagtcgcctattgcggtatttgcggcagcgac
ctgcacgagtacgccgacggcccgcattccattccggtggtgcagcctcatcccttgtcc
ggtcgccaggcgccgctcattatcggccacgagttctgcggcacggtattggaaaccgcg
gccgacgtgaccacgctgcgccccggcgcacgggtgacgatagagccggagtaccgttgc
gggcattgcacgcattgcctggcgggcgactacaacctgtgcgtgtccatggggtttgca
ggattgatgggcgatggcggcatggcccagcaggcggtcgtgccagcctatatggcgcat
gagttgccgaacgaggtaccgttcgagcaggccgcagtggcggaacccgctgccgtggcg
ctgcatgccgtcaggcgcagccgtctgcggcctggggatacctgcgtgatcttcgggctg
ggtgccatcggccagttgctggtgatgatggcgcgcctgcagggggccgggcaaatcatt
gccgtcgatgtcgtgcccgctcgcctggcgttggcaaggcagttgggcgccgacctgacc
ctggatgcccgccatgacgatgtgctcactgtggcgctggcgcacaccgatggcgccggg
gcaccggtcagtttcgaggcggcaggcagccaggcgaccttcgacggtgcgttgcaggtg
ctgtgcaagggcggggaaatggtgctggtggggctggtgccccaggtgaggctggacagt
tttgacctggtcaaccgggagttgagcattaccagcagcgttggctatcgcggggtctat
ccggacctgttggcctggattgcagaaggcagcctggatctttctcaggtcgtgactcgt
attgtggcattggaagatgccgtgacagatggctttgaagcgcagttgcaaagccgcgac
gagatcaagattctggtgcggccttgtggttga

DBGET integrated database retrieval system