KEGG   Bordetella sp. J329: CBF45_06950
Entry
CBF45_06950       CDS       T05850                                 

Definition
(GenBank) 2-oxo-3-hexenedioate decarboxylase
  KO
K01617  2-oxo-3-hexenedioate decarboxylase [EC:4.1.1.77]
Organism
boj  Bordetella sp. J329
Pathway
boj00362  Benzoate degradation
boj00621  Dioxin degradation
boj00622  Xylene degradation
boj01100  Metabolic pathways
boj01120  Microbial metabolism in diverse environments
boj01220  Degradation of aromatic compounds
Module
boj_M00569  Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA
Brite
KEGG Orthology (KO) [BR:boj00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CBF45_06950
   00622 Xylene degradation
    CBF45_06950
   00621 Dioxin degradation
    CBF45_06950
Enzymes [BR:boj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.77  2-oxo-3-hexenedioate decarboxylase
     CBF45_06950
SSDB
Motif
Pfam: FAA_hydrolase DUF411
Other DBs
NCBI-ProteinID: AZV93486
LinkDB
Position
complement(1585199..1585987)
AA seq 262 aa
MTLDASTREALAQQLDHAERERRPIPRITDAQPLMDWDDAYAIQDLLRARKQARGIAVSG
LKMGLTSQAKMQQMGVTEPIHGFITADGAIANGGDIRMDELIHPKIEAEIAFILQRPLTG
PGIHAGDVLAATACILPAVEIIDSRYENFRFDLKSVIADNTSAARYVTGDTIRPAQDLDL
RHLGVVLERNGRLLATAAGAAVLGNPINSVAMLANMLGRQGRSLPAGQLILTGGITEAFQ
VSRGDHIRVRYEHLGEVSMHFI
NT seq 789 nt   +upstreamnt  +downstreamnt
atgacacttgacgcaagcacccgcgaagcactggcgcagcaactggaccatgctgaacgc
gaacgccgccccatcccccgcattaccgatgcccagccgctcatggactgggatgatgcc
tacgccatccaggatctcctgcgcgcccgtaaacaggcgcgcggcattgctgtctccggc
ctgaaaatgggcctgacgtcacaggccaagatgcagcagatgggcgtaaccgagcccata
cacggcttcatcactgccgacggcgccatcgccaacggcggcgacattcgcatggatgag
ctgatacacccgaaaatcgaggccgagatcgccttcatcctgcaacggccgctgacgggc
ccgggcatacacgcgggtgatgtgctggctgccacggcctgcatcctgccagctgtcgaa
atcattgattcgcgctatgagaacttccgctttgatctcaaaagcgtcatcgccgacaac
acatctgccgcgcgctatgtgaccggcgataccatccgcccggcacaggacctggacctc
cggcacctgggcgtggtgctggaacgcaacggccgcctgcttgccacggcagccggtgca
gcggtgctcggcaaccccatcaacagtgtcgccatgctcgccaacatgctggggcgccag
ggccgcagcctgccggccggccagctgattctgacgggaggcatcaccgaagccttccag
gtatcacgtggcgaccacatacgcgtgcgctacgaacacctgggcgaagtctccatgcat
ttcatctga

DBGET integrated database retrieval system