KEGG   Bordetella sp. J329: CBF45_11030Help
Entry
CBF45_11030       CDS       T05850                                 

Definition
(GenBank) ribose 5-phosphate isomerase A
  KO
K01807  ribose 5-phosphate isomerase A [EC:5.3.1.6]
Organism
boj  Bordetella sp. J329
Pathway
boj00030  Pentose phosphate pathway
boj01100  Metabolic pathways
boj01110  Biosynthesis of secondary metabolites
boj01120  Microbial metabolism in diverse environments
boj01130  Biosynthesis of antibiotics
boj01200  Carbon metabolism
boj01230  Biosynthesis of amino acids
Module
boj_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:boj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    CBF45_11030
Enzymes [BR:boj01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.6  ribose-5-phosphate isomerase
     CBF45_11030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rib_5-P_isom_A
Motif
Other DBs
NCBI-ProteinID: AZV94195
UniProt: A0A3T0NG48
LinkDB All DBs
Position
complement(2493897..2494583)
Genome map
AA seq 228 aa AA seqDB search
MLSQQQLKQQAADVALAYIEPMLGADVIIGVGTGSTADLFIDGLARYAGRFRGAVASSVR
SAERLAGHGIAVLDLNDVQHMPVYVDGADEIDAGMNMIKGGGGALTREKIVASVADEFVC
IADDSKLVRRLGRFPLPVEVIPMAREAVARALRAYGGIPALREGFVTDNGNVILDVSGLE
INEPARLEQEINNLPGVVTCGLFALRGANLALLAGSDGVQRLLPGARG
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgttgtcgcagcaacaactcaagcagcaagcggccgatgtcgccttggcctatatcgaa
cccatgctgggcgcggatgtcatcatcggcgtgggcacgggttccacggcggatcttttc
atcgacggcctggcgcgctatgccggccgcttccgcggtgcggtggccagttcggtgcgc
agcgccgagcgcctggccggccacggtatcgccgtgctggacctcaatgacgtgcagcac
atgccggtgtatgtcgatggcgccgacgaaatcgacgctggcatgaatatgatcaagggc
ggaggtggcgcgctgacgcgcgagaaaatcgtcgcctcggtggcggacgaattcgtgtgc
attgctgacgacagcaagctggtccggcgcctggggcgcttcccgctgccggtggaagtc
attcccatggcgcgcgaagccgtggcccgtgcgttgcgtgcctatggcggcataccggcg
ttgcgcgagggcttcgtgaccgacaacggcaatgtcatcctggacgtttccggcctggaa
atcaacgaaccggcccgcctggagcaggaaatcaacaacctgccaggtgtcgtcacctgc
ggcctgttcgcgctgcgcggtgcgaacctggcgctgttggcgggcagcgacggcgtgcag
cgcctgctgccgggcgcgcgcggctga

DBGET integrated database retrieval system