KEGG   Bordetella sp. J329: CBF45_14615Help
Entry
CBF45_14615       CDS       T05850                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
boj  Bordetella sp. J329
Brite
KEGG Orthology (KO) [BR:boj00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CBF45_14615
Enzymes [BR:boj01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     CBF45_14615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_binding_2 HI0933_like DAO FAD_oxidored Glutaredoxin K_oxygenase FAD_binding_3 NAD_binding_8 NAD_binding_9 Thi4 Thioredoxin_4 FMO-like
Motif
Other DBs
NCBI-ProteinID: AZV94797
LinkDB All DBs
Position
complement(3296512..3298092)
Genome map
AA seq 526 aa AA seqDB search
MSLDANLKNQLKAYLERVTQPVELVASLDDGAKSKELRELLQEIAALSDRVSFVERDEAG
VRKPSFSVNRPGENIGIRFAAIPMGHEFTSLVLALLQVGGHPIKFEPEVVEQIRNLDGEY
LFETYMSLSCQNCPDVVQALNAMAVINPRIRNVVIDGALFQDEVEQRQIMAVPTVYLNGE
VFGQGRSSVEEILAKLDSGAAARKAAQLDAKDAFDVLVVGGGPAGAAAAVYAARKGIRTG
VVAERFGGQVLDTMAIENFISVPHTEGPRFAAALEEHVKSYDVDIMNLQRVVALEEGDGL
LSVKLESGAELRSRSVILATGARWREINVPGEREYRNHGVAYCPHCDGPLFKGKRVAVIG
GGNSGVEAAIDLAGVVGHVTLIEFGEALRADAVLQRKLYSLPNVEVILHAQTTEIVGDGQ
KVNGLVYTDRKSGESRKVELAGVFIQIGLVPNSEWLKGTLNLSKHGEIEVDTRGATSLPG
VFAAGDVTTVPYKQIIIAAGEGAKAALGAFDYLIRQPAAGEAEVTA
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgtcgttggatgccaacctcaagaatcaattgaaagcctatctggaacgtgtcacgcag
ccggtagagctcgttgcgtcgcttgacgatggcgccaagtccaaggagctgcgtgaactg
ctgcaggaaatcgcagcgctgtccgatcgcgtgagctttgtcgagcgcgacgaggccggt
gtgcgcaaaccgtccttcagcgtcaatcgccctggcgagaatatcggcattcgtttcgcc
gctatccccatgggtcacgaattcacctcgctggtgcttgccctgttgcaggtcggcggc
catccgatcaaattcgagccggaagtcgtcgagcagatccgcaacctcgatggcgagtac
ctgtttgaaacctatatgtcgctgagctgccagaactgcccggacgtggtccaggcgctc
aacgcgatggcagtcatcaacccgcgtatccgcaacgttgtcatcgacggcgcgctgttc
caggatgaagtcgagcagcgccagatcatggccgtgccgaccgtctacctgaatggcgaa
gtgttcggccagggccgttcctcggtcgaggaaatcctggccaagctcgatagcggcgcg
gcagcgcgcaaggctgcccagctcgacgccaaggatgccttcgacgtgctggtcgtcggt
ggtggcccggccggtgccgcagcggcggtctatgcggctcgcaagggtatccgcacgggc
gtggtggccgagcgttttggcggccaggtgctcgacaccatggcaatcgagaacttcatc
tcggtgcctcataccgaaggcccgcgctttgccgcggcgctggaagagcacgtcaagtcg
tatgacgtggacatcatgaacctgcagcgcgtcgttgcgctggaggaaggcgatggtctg
ctgtcggtcaagctggaaagcggtgcagaattgcgcagccgttcggtcattctggcgacg
ggcgcgcgctggcgcgaaatcaacgtgccgggtgagcgcgaataccgcaaccatggcgtg
gcctactgcccgcactgcgacggcccgctgttcaagggcaagcgcgtcgcggtgattggc
ggcggcaactccggcgtggaagcggccatcgacctggccggtgtggtcggccacgtcacg
ctgatcgaattcggcgaagcgctgcgtgccgatgccgtgctgcaacgcaagctctacagc
ctgccgaacgtcgaagtcatcctgcatgcgcagaccacggaaatcgtgggtgacggccag
aaggtcaacggcctggtctataccgatcgcaagagcggagaaagccgcaaggtcgagctg
gctggtgtgtttatccagatcggcctggtgcccaacagcgaatggctcaagggcacgctg
aatctctccaagcatggcgagatcgaagtggatacgcgtggcgcaacctcgctgcccggc
gtattcgctgccggcgacgtgacgacggtgccctacaagcagatcatcatcgctgcgggt
gaaggcgccaaggcagctctgggcgcattcgactacctgatccgccagccggcggcaggc
gaggcggaagtgactgcctga

DBGET integrated database retrieval system