KEGG   Bordetella sp. J329: CBF45_14950Help
Entry
CBF45_14950       CDS       T05850                                 

Definition
(GenBank) thiol reductant ABC exporter subunit CydC
  KO
K16012  ATP-binding cassette, subfamily C, bacterial CydC
Organism
boj  Bordetella sp. J329
Pathway
boj02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:boj00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    CBF45_14950
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:boj02000]
    CBF45_14950
Transporters [BR:boj02000]
 ABC transporters, eukaryotic type
  ABCC (CFTR/MRP) subfamily
   ABCC-BAC subgroup
    CBF45_14950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran ABC_membrane AAA_21 AAA_16 AAA_22 AAA_29 AAA_25 RsgA_GTPase AAA_30 MMR_HSR1 AAA_28 AAA_33 EI24 DUF87 Zeta_toxin
Motif
Other DBs
NCBI-ProteinID: AZV94856
UniProt: A0A3T0NHY7
LinkDB All DBs
Position
complement(3376799..3378484)
Genome map
AA seq 561 aa AA seqDB search
MKSLWRLLSPMYRQRRDGLLVALLLTIVALLAGVGLLGVSGWFLTGAALAGAGAAFNLFA
PSALVRGFSFIRILARYGERLTGHDATLKLLADLRGNIFRRLLKLDPAQLARYRDGDLVA
RLTGDVDALDTVYLFAIAPIITALCVGGILVAVLGAWVPAAALVLLAGILLATLVVPAWL
ARSARRPGAVVQQTSAALRDGVLEAVQAHADLLALDAAEEARKAFAANCLEAAVARERQA
AIGSAGQLVLQAVAGLCVVAVLYFGIEPLRGGTVSGPVLAGMVLAVLGVFEVIGPIMRGA
SRLGAAAAAARRIEALAEEPPQIVDPAHPVALPQHGEVVFDKVFYAYGKAGDERGGDVLR
GLDLRLRPGELVAVVGASGAGKSTLLSLLLRLADPRQGTVSFGGVALSDTRQEEVHARVA
LLSQNEPVFLGTIRSNLQIGAPEADDDTLWRALDDARLGDFVRTLPDGLDTWTGETGRTL
SAGQARRLCLARALLSPAQVLALDEPTQGLDAEAERAFLSDLASAARGRAVLLVTHARLP
EGAADRVLELRDGVLLPLMPR
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atgaagtccctgtggcgcctgcttagtcccatgtatcgccagcgccgcgacggcttgctg
gtggcgctgttgctgaccattgtcgcgctgcttgccggcgtcggcctgctgggtgtgtcc
ggttggttcctcactggtgccgccctggcgggcgctggcgcggcgttcaatctgttcgcg
ccctcggcgctggtgcgaggcttttcctttatccgcattctggcccgctatggcgaacgg
ctgaccggccacgacgcgacgctcaagttactggctgacctgcgcggcaacatcttccgc
cgtctgctgaagctggacccggcgcagctggcgcgctatcgcgatggcgacctggtggcg
cgtctgactggcgacgttgacgcgctggataccgtctatctgtttgcaatcgcgcccatc
atcaccgccttgtgcgtgggcggcatcctggttgccgttctcggcgcctgggtgcctgcg
gctgcgctggtgctgctggctggcattctgcttgccacgctggtggtgccggcttggctg
gcgcgcagcgccaggcgtccgggcgccgtcgtgcaacagacctcagccgcgttgcgggat
ggcgtgctggaagccgtgcaggcgcacgccgacctgctggcgctggatgccgctgaagag
gcccgcaaggcctttgccgccaattgcctggaggcggccgtggcgcgtgagcgccaggct
gccattggctcggcgggccagctggtgttgcaggccgtggccggactatgcgttgtggca
gtgctttattttggtatcgaacctctgcgaggcggtacggtgagcggcccggtgttggcc
ggtatggtgctggccgtactgggcgtgttcgaggtcattggccccatcatgcgcggggcc
tcgcgcctgggcgctgccgccgctgccgcgcgccgcatcgaggcgctggcggaagagccg
ccacagatcgtcgaccccgctcatccggtggccttgccgcaacacggcgaggttgtcttc
gacaaggtattttatgcctatggcaaggccggcgacgaacgtggtggcgacgtcctgcgc
gggctggacttgcgcctgaggcctggcgaattggtggcggtggttggcgccagcggcgcc
gggaaatcgaccttgctgagcttgctgctgcgcctggccgacccgcgccagggcaccgtg
agctttggcggcgtggcgctgagcgatacccgtcaggaagaggtgcacgccagggtggcc
ttgctgtcgcagaacgaaccggtattcctgggcaccatacgcagcaatctgcagatcggt
gcgccagaggcggacgatgacacgctgtggcgtgcgctggacgatgcgcggctgggcgat
ttcgtgcgtacgctgcccgatggcctggatacctggacgggtgaaactggccgtaccctt
tcggcagggcaggcacgccggttgtgcctggcgcgtgccttgctttcgcccgcacaggtg
ctggcgctggatgaaccgacgcagggcctggacgccgaagccgaacgcgccttcctgtcg
gacctggccagcgcggccagggggcgagccgtgctgctcgtgacccatgcgcgcctgccc
gaaggcgcggcagaccgtgtcctggagctgcgcgatggtgtcctgcttccgctgatgccg
cgctga

DBGET integrated database retrieval system