KEGG   Burkholderia oklahomensis E0147: DM82_1037
Entry
DM82_1037         CDS       T03284                                 

Gene name
lpdA
Definition
(GenBank) dihydrolipoyl dehydrogenase
  KO
K00382  dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
bok  Burkholderia oklahomensis E0147
Pathway
bok00010  Glycolysis / Gluconeogenesis
bok00020  Citrate cycle (TCA cycle)
bok00260  Glycine, serine and threonine metabolism
bok00280  Valine, leucine and isoleucine degradation
bok00310  Lysine degradation
bok00380  Tryptophan metabolism
bok00620  Pyruvate metabolism
bok00630  Glyoxylate and dicarboxylate metabolism
bok00640  Propanoate metabolism
bok01100  Metabolic pathways
bok01110  Biosynthesis of secondary metabolites
bok01120  Microbial metabolism in diverse environments
bok01200  Carbon metabolism
Module
bok_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bok_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
bok_M00036  Leucine degradation, leucine => acetoacetate + acetyl-CoA
bok_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bok00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DM82_1037 (lpdA)
   00020 Citrate cycle (TCA cycle)
    DM82_1037 (lpdA)
   00620 Pyruvate metabolism
    DM82_1037 (lpdA)
   00630 Glyoxylate and dicarboxylate metabolism
    DM82_1037 (lpdA)
   00640 Propanoate metabolism
    DM82_1037 (lpdA)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DM82_1037 (lpdA)
   00280 Valine, leucine and isoleucine degradation
    DM82_1037 (lpdA)
   00310 Lysine degradation
    DM82_1037 (lpdA)
   00380 Tryptophan metabolism
    DM82_1037 (lpdA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bok04147]
    DM82_1037 (lpdA)
Enzymes [BR:bok01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     DM82_1037 (lpdA)
Exosome [BR:bok04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   DM82_1037 (lpdA)
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox Pyr_redox_3 FAD_binding_2 HI0933_like AlaDh_PNT_C FAD_oxidored NAD_binding_8 FAD_binding_3 GIDA 3HCDH_N K_oxygenase Thi4 DAO Amino_oxidase 2-Hacid_dh_C Lycopene_cycl
Other DBs
NCBI-ProteinID: AIO67664
LinkDB
Position
1:1197546..1198976
AA seq 476 aa
MSKEFDVVVIGAGPGGYIAAIRAAQLGKTVACIEKWKNPAGALKLGGTCLNVGCIPSKAL
LASSEEFEKASHHLADHGISVGDVKMDVAKMIGRKDAIVEKMTGGIEFLFKKNKIMWLKG
HGKFTGKTDAGVQIEVSGEGETEVVTAKNVIIATGSKARHLPNVPVDNKIVADNEGALTF
DTVPKKLAVIGAGVIGLELGSVWRRLGAEVTVLEALPAFLGAADEALAKEAAKLFKKQGL
DINLGVKIDEVKTGANGVSIAYTDKDGNAKTLEADRLIVSIGRVPNTDNLGLEAIGLKAN
ERGFIDVDDHCRTAVPNVYAIGDVVRGPMLAHKAEDEGVLVAEVIDGQKPHIDYNCIPWV
IYTEPEIAWVGKTEQQLKAEGREIKSGKFPFSINGRALGMGRSDGFVKMIADAKTDELLG
VHVISPNASDLIAEAVVAMEFKAASEDIARICHPHPSLSEVMREAALAVDKRSLNS
NT seq 1431 nt   +upstreamnt  +downstreamnt
atgtcgaaggaatttgacgtcgtcgtgatcggcgccggccctggcggctacatcgccgcg
atccgcgccgctcagttgggcaaaacggttgcctgtatcgaaaaatggaagaacccggcg
ggcgcgctgaagttgggcggcacgtgcctgaacgtcggctgcatcccgtcgaaggcgctc
ctcgcctcgtcggaagagttcgagaaggcgtcgcatcacctcgccgaccacggcatcagc
gtcggcgacgtgaagatggacgtcgcgaagatgatcggccgcaaggatgcgatcgtcgag
aagatgacgggcgggatcgaattcctgttcaagaagaacaagatcatgtggctgaagggc
cacggcaagttcaccggtaagaccgacgccggcgtgcagatcgaagtgagcggcgaaggc
gaaaccgaagtcgtcaccgcgaagaacgtgatcatcgcgacgggctcgaaggcgcgccat
ctgccgaacgtgccggtcgacaacaagatcgtcgcggacaacgaaggcgcgctgacgttc
gacacggtgccgaagaagctcgccgtgatcggcgcgggcgtgatcggcctcgagctcggc
tcggtgtggcgccgcctcggcgccgaagtgacggtgctcgaagcgctgccggccttcctc
ggcgcggccgacgaagcgctcgcgaaggaagcggcgaagctgttcaagaagcaaggcctc
gacatcaacctcggcgtgaagatcgacgaagtgaagacgggcgcgaacggcgtgtcgatc
gcatacaccgacaaggacggcaacgcgaagacgctcgaagcggatcgcctgatcgtgtcg
atcggccgcgtgccgaacaccgacaatctcggcctcgaggcgattggcctgaaggcgaac
gagcgcggcttcatcgacgtcgacgaccactgccgcaccgcggtgccgaacgtctacgcg
atcggcgacgtcgtgcgcggcccgatgctcgcgcacaaggcggaagacgaaggcgtgctc
gtcgcggaagtgatcgacggccagaagccgcacatcgactacaactgcattccgtgggtg
atctacaccgagccggaaatcgcgtgggtcggcaagaccgagcagcaactgaaggcggaa
ggccgcgagatcaagtcgggcaagttcccgttctcgatcaacggccgcgcgctcggcatg
ggccgttcggacggtttcgtgaagatgatcgccgatgcgaagacggacgagctgctcggc
gtgcacgtgatctcgccgaatgcgtcggacctgatcgccgaagccgtggtcgcgatggaa
ttcaaggcggcgtcggaagacatcgcccgaatctgccatccgcatccgtcgttgtccgaa
gtgatgcgcgaagcggcgctcgccgtcgacaagcgctcgctcaacagctaa

DBGET integrated database retrieval system