KEGG   Burkholderia oklahomensis E0147: DM82_1382
Entry
DM82_1382         CDS       T03284                                 

Definition
(GenBank) FAD binding domain protein
Organism
bok  Burkholderia oklahomensis E0147
SSDB
Motif
Pfam: Trp_halogenase FAD_binding_3 DAO Pyr_redox_2 FAD_binding_2 NAD_binding_8 HI0933_like FAD_oxidored NAD_binding_7 GIDA Pyr_redox Thi4 AlaDh_PNT_C Lycopene_cycl 3HCDH_N UDPG_MGDP_dh_N Pyr_redox_3
Other DBs
NCBI-ProteinID: AIO65419
LinkDB
Position
1:1577418..1578860
AA seq 480 aa
MRLPNRTKVLVIGGGPAGATGAAFLAREGIDVTLVDKEVFPRYHIGESLLPSCLEILTLM
GARDTFDRHGFQRKPGAYFNWKGETWKLDFGELGGTYHYSYQVRREEFDHLLLQHARAVG
AKVHEGVSVREIRFDDGRPCAALCVAQGSDETTVVEFDYLVDASGRNGLMSTRYLDNRKF
HEIFRNVAAWGYWEGLAWPDDCAPGSILVSSIPDGWWWAIPLADRPTSVGVVMHRDAFVA
AKRSGSLEQVYERAIALSPVMTKLTQHARLVTPLKTEQDYSYTCDSFAGDGYFLSGDAAC
FLDPLLSTGVHLAMYSGMLAAASLASILRDEVSEREAAVYYRDSYQQAYLRFLVFVQTFY
EAHGKLGYYSKADELSHYMIEAGDIRRAFLNLVSGLEDIADVEQATSHLMGEMSRRIDQN
LALRKDKGALAAAIGSSEIEDNARFFDAIEGLPCLSQNMALDGLYVSTRPRLGLQRVAAA
NT seq 1443 nt   +upstreamnt  +downstreamnt
atgcgtcttccgaatcgcaccaaagtcctcgtgatcggcggcggtccggccggggcaacc
ggcgcggcgtttctcgcccgagaaggcatcgatgtcacgctggtcgacaaagaggtgttc
ccccgctatcacatcggcgaatcgctgctgccgtcgtgcctcgaaatcctcacgctgatg
ggcgcgcgcgacacgttcgaccgtcacggcttccaacgcaagccgggcgcctacttcaac
tggaaaggcgagacctggaaactcgatttcggcgagctcggcggcacctatcactacagc
taccaagtgcgtcgcgaggaattcgaccacctgctcctgcagcatgcgcgagcggttggt
gcgaaggtgcacgaaggcgtgagcgtgcgcgaaatccggttcgacgacggccgtccgtgc
gccgccttgtgcgtcgcgcaaggctccgacgagacgaccgtcgtcgaattcgactatctc
gtcgacgcgtcgggacgcaacgggctgatgtcgacccgatacctggacaaccgcaaattc
cacgagatcttccgcaatgtcgcggcctggggctactgggaaggtctcgcatggcccgac
gattgcgcgccgggctcgattctcgtcagctcgattccggacggctggtggtgggcgata
ccgctcgccgatcgtccgacgagcgtcggcgtcgtcatgcaccgcgacgcattcgtcgcg
gcgaagcggtccggctcgctcgagcaggtctacgagcgggcgatcgcgctgagcccggtg
atgacgaagctgacgcagcacgcgcgcctcgtcacgccgctcaagaccgagcaggactat
tcgtacacctgcgattccttcgcgggcgacggctacttcctgtccggcgacgccgcgtgc
tttctcgacccgctgctgtccacgggcgttcacctcgcgatgtacagcgggatgctcgcc
gccgcatcgctcgccagcatcctgcgcgacgaagtgtccgagcgggaggccgccgtgtac
tatcgcgacagctatcaacaggcctacctgcgctttctcgtgttcgtgcagacgttctac
gaagcgcacggcaagctcggctactacagcaaggccgacgagctgagccactacatgatc
gaggcgggcgacatccggcgcgcgttcctgaatctcgtgtccggcctcgaagacatcgcc
gacgtcgagcaggccacgtcgcacctgatgggcgaaatgtcccgccgcatcgatcagaat
ctcgcgcttcgcaaggacaagggcgcgctcgccgcggcgatcggcagctcggaaatcgag
gacaacgcgcgattcttcgacgcgatcgagggcctgccctgcctgtcgcagaacatggcg
ctcgacgggctttacgtgtcgacccggccgcggctcggcctgcagcgggtcgccgcggca
tag

DBGET integrated database retrieval system