KEGG   Burkholderia oklahomensis E0147: DM82_1437Help
Entry
DM82_1437         CDS       T03284                                 

Definition
(GenBank) aldehyde dehydrogenase family protein
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
bok  Burkholderia oklahomensis E0147
Pathway
bok00010  Glycolysis / Gluconeogenesis
bok00053  Ascorbate and aldarate metabolism
bok00071  Fatty acid degradation
bok00280  Valine, leucine and isoleucine degradation
bok00310  Lysine degradation
bok00330  Arginine and proline metabolism
bok00340  Histidine metabolism
bok00380  Tryptophan metabolism
bok00410  beta-Alanine metabolism
bok00561  Glycerolipid metabolism
bok00620  Pyruvate metabolism
bok00625  Chloroalkane and chloroalkene degradation
bok00903  Limonene and pinene degradation
bok01100  Metabolic pathways
bok01110  Biosynthesis of secondary metabolites
bok01120  Microbial metabolism in diverse environments
bok01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bok00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DM82_1437
   00053 Ascorbate and aldarate metabolism
    DM82_1437
   00620 Pyruvate metabolism
    DM82_1437
  09103 Lipid metabolism
   00071 Fatty acid degradation
    DM82_1437
   00561 Glycerolipid metabolism
    DM82_1437
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    DM82_1437
   00310 Lysine degradation
    DM82_1437
   00330 Arginine and proline metabolism
    DM82_1437
   00340 Histidine metabolism
    DM82_1437
   00380 Tryptophan metabolism
    DM82_1437
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    DM82_1437
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    DM82_1437
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    DM82_1437
Enzymes [BR:bok01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     DM82_1437
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AIO66885
UniProt: A0A088WXK9
LinkDB All DBs
Position
1:complement(1635431..1636867)
Genome map
AA seq 478 aa AA seqDB search
MKTYEQFYIGGAWRPSAGNGTIDVIDSGTEAVIGRVPEGTAEDAKAAVAAARAAFDGWAA
TPPAERARYLYKITENLKARSEELAQSITGEVGMPIKLSRAIQVGGPVYNWGAYAKLAET
FAFEEQVGNSLVVREPVGVVAAITPWNYPLNQITLKVAAALAAGCTVALKPSEVAPLNAF
MLAEAIHDAGLPAGVFNLVCGYGPVVGEALASDPDVDMVSFTGSTRAGKRVAELAAAGVK
RVALELGGKSASVILDDADFAAAVKGTVSACYLNAGQTCSAHTRMLVPESRYDEARELAK
AAAEAYVAGDPRDDATRLGALASAVQQARVQDYIRRGIDEGAELVTGGLGMPEGLTRGFF
VKPTVFGRVKPDATIAQEEIFGPVLSIVTYRDDDDAVRIANDSPYGLGGAVWSGSDEHAL
RVARRIRTGQVDINGGAWNMAAPFGGFKQSGIGRENGVYGLEEYLEYKSMQLRPKKNA
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgaagacctacgaacagttctacatcggcggcgcgtggcgcccgagcgccggcaacggc
acgatcgacgtgatcgactccggcacggaggccgtgatcggccgcgttcccgagggcacc
gccgaagacgcgaaagcggccgtcgccgccgcgcgcgccgcgttcgacggctgggccgcg
acgccgcccgccgagcgcgcccgctatctctacaagatcaccgaaaacctgaaggcgcgc
agcgaggaactcgcgcagtcgatcacgggcgaagtcggcatgccgatcaagctgtcgcgc
gcgatccaggtcggcgggccggtctacaactggggcgcgtatgcgaagctcgccgagacg
ttcgcgttcgaagagcaggtcggcaattcgctcgtcgtgcgcgagccggtcggcgtcgtc
gcggcgatcacgccgtggaactatccgctcaaccagatcacgctgaaggtcgcggccgca
ctcgcggcaggctgcaccgtcgcgctgaagccgtccgaagtcgcgccgctcaatgcgttc
atgcttgccgaagcgattcacgatgccgggctgcccgccggcgtgttcaatctcgtatgc
ggctacgggcccgtcgtcggcgaagcgctcgcgagcgatcccgatgtcgacatggtgtcg
ttcaccggctcgacgcgcgcgggcaagcgcgtcgccgagctggccgcggccggcgtgaag
cgcgtcgcgctcgaactgggcggcaagtccgcgtcggtgattctcgacgacgcggatttc
gcggccgcggtgaagggtacggtatccgcgtgctatctgaacgcgggccagacgtgctcc
gcgcacacgcggatgctcgtgccggaatcgcgctacgacgaagcgcgcgagctcgcgaag
gcggcggccgaagcatatgtcgcgggcgacccgcgcgatgacgcgacgcggctcggcgca
cttgcgtcggcggttcagcaagcgcgcgtgcaggactacatccggcgcggcatcgacgaa
ggcgcggaactcgtcacgggcgggctcggcatgccggagggcctgacgcgcggtttcttc
gtgaagccgaccgtgttcggccgcgtgaagcccgatgcgacgatcgcacaggaggaaatc
ttcggcccggtgctgtcgatcgtcacgtatcgcgacgacgacgacgcggtgcggatcgcg
aacgattcgccgtacggtctcggcggcgcggtgtggtcgggcagcgacgagcacgcgctg
cgcgtcgcgcggcgcattcgcacgggccaggtcgacatcaacggcggtgcctggaacatg
gctgcgccattcggcggtttcaaacagtcggggatcggccgcgagaacggtgtgtacggg
ctcgaggaatatctggaatacaaatcgatgcagttgcgtccgaaaaagaacgcataa

DBGET integrated database retrieval system