KEGG   Burkholderia oklahomensis E0147: DM82_1853
Entry
DM82_1853         CDS       T03284                                 

Definition
(GenBank) hypothetical protein
  KO
K11007  shiga toxin subunit B
Organism
bok  Burkholderia oklahomensis E0147
Pathway
bok02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:bok00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    DM82_1853
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:bok02042]
    DM82_1853
Bacterial toxins [BR:bok02042]
 Type III toxins: Intracellular toxins
  Others
   Shiga toxin
    DM82_1853
SSDB
Motif
Pfam: LPAM_1
Other DBs
NCBI-ProteinID: AIO66307
UniProt: A0A381BPX0
LinkDB
Position
1:complement(2141053..2141325)
AA seq 90 aa
MKKTLAAIVSALLLASSYAHADTLCTSGTINKLFIDNNGVMEVTVGNLSYLNGNKDAYPL
INSAFVMGKQVYIYASTCQPGTSMGGFAVR
NT seq 273 nt   +upstreamnt  +downstreamnt
atgaaaaagactctcgctgctatcgtttcagccttgcttctggcttcgtcctatgcgcac
gcggatacgttgtgcacgtcgggcacgatcaacaagctcttcatcgacaacaacggggtc
atggaggtcaccgtcggcaacctgtcctacttgaacggaaacaaggatgcgtatccgctc
atcaattcggcgttcgtgatgggcaagcaggtctatatctacgcgagcacttgccagccg
ggcacatcgatgggaggctttgccgttcggtaa

DBGET integrated database retrieval system