KEGG   Burkholderia oklahomensis E0147: DM82_1902
Entry
DM82_1902         CDS       T03284                                 

Gene name
lpdA
Definition
(GenBank) dihydrolipoyl dehydrogenase
  KO
K00382  dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
bok  Burkholderia oklahomensis E0147
Pathway
bok00010  Glycolysis / Gluconeogenesis
bok00020  Citrate cycle (TCA cycle)
bok00260  Glycine, serine and threonine metabolism
bok00280  Valine, leucine and isoleucine degradation
bok00310  Lysine degradation
bok00380  Tryptophan metabolism
bok00620  Pyruvate metabolism
bok00630  Glyoxylate and dicarboxylate metabolism
bok00640  Propanoate metabolism
bok01100  Metabolic pathways
bok01110  Biosynthesis of secondary metabolites
bok01120  Microbial metabolism in diverse environments
bok01200  Carbon metabolism
Module
bok_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bok_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
bok_M00036  Leucine degradation, leucine => acetoacetate + acetyl-CoA
bok_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bok00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DM82_1902 (lpdA)
   00020 Citrate cycle (TCA cycle)
    DM82_1902 (lpdA)
   00620 Pyruvate metabolism
    DM82_1902 (lpdA)
   00630 Glyoxylate and dicarboxylate metabolism
    DM82_1902 (lpdA)
   00640 Propanoate metabolism
    DM82_1902 (lpdA)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DM82_1902 (lpdA)
   00280 Valine, leucine and isoleucine degradation
    DM82_1902 (lpdA)
   00310 Lysine degradation
    DM82_1902 (lpdA)
   00380 Tryptophan metabolism
    DM82_1902 (lpdA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bok04147]
    DM82_1902 (lpdA)
Enzymes [BR:bok01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     DM82_1902 (lpdA)
Exosome [BR:bok04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   DM82_1902 (lpdA)
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Biotin_lipoyl Pyr_redox Biotin_lipoyl_2 FAD_oxidored GIDA Pyr_redox_3 AlaDh_PNT_C NAD_binding_8 FAD_binding_2 DAO Thi4 GCV_H HI0933_like Peptidase_M23 NAD_binding_7 FAD_binding_3 RnfC_N HlyD_D23
Other DBs
NCBI-ProteinID: AIO65742
LinkDB
Position
1:complement(2193808..2195562)
AA seq 584 aa
MSLIEVKVPDIGDFSGVDVIEVNVKPGDVIEKEQTLITLESDKASMEVPSDVAGTVKEIK
VKAGDKVSQGTVIALVEAAAAAAPAKPAEPAKPAAAAPAAAPAPAPQAGSFGGSADIECD
MLVLGAGPGGYSAAFRSADLGMKTVLVERYSTLGGVCLNVGCIPSKALLHTALVVEEAKA
LAAHGISFGKPEVDLDKLRDFKGGVVKKLTTGLAGMAKARKVDVVTGVGAFVDPHHMEVQ
TDGGKKVVKFKQAIIAAGSQAMKLPFMPEDPRVVDSTGALELRQLPKRMLVIGGGIIGLE
MATVYSTLGADIDVVEMMDGLMMGADRDLVKVWEKYNAKRFGNVMLKTKTVGAEAKEDGI
YVKFEGEKAPAEAQRYDLVLVAVGRSPNGKKIGADKAGVAVTDRGFIEVDKQMRTNVPHI
FAIGDVVGQPMLAHKAVHEGHVAAEAAHGEKAYFDALQIPSVAYTDPEVAWAGKTEDQCK
AEGIKYGKAVFPWAASGRAIANGRDEGFTKLLFDEETHRVIGGGIVGLNAGDLISEVCLA
VEMGADAEDIGKTIHPHPTLGESIGMAAELYEGVCTDLPPQRKK
NT seq 1755 nt   +upstreamnt  +downstreamnt
atgagtctcatcgaagtcaaggtgccggatatcggcgatttcagcggcgtcgacgtcatc
gaagtcaacgtcaagccgggcgacgtgatcgaaaaagagcagacgctcatcacgctcgaa
tcggacaaggcgtccatggaagtgccgagcgacgtcgccggcacggtgaaggaaatcaag
gtcaaggcaggcgacaaggtctcgcagggcacggtgatcgcgctcgtcgaggcggccgca
gcagcagcgcccgcgaagcccgccgagccggcaaaaccggctgcggccgcgcccgcagcc
gcaccggcgcccgcgccgcaagccggcagcttcggcggctcggccgacatcgagtgcgac
atgctcgtgctcggcgcgggccccggcggctattcggccgcgttccgttcggcggatctc
gggatgaagacagtgctcgtcgagcgctattccacgctcggcggcgtatgcctgaacgtc
ggctgcattccgtcgaaggcgctcctgcatacggcgctcgtcgtcgaggaagcgaaagcg
ctcgccgcgcacggcatctcgttcggcaagcccgaggtcgatctcgacaagctgcgcgac
ttcaagggcggcgtcgtcaagaagctgacgacgggcctcgccggcatggcgaaggcgcgc
aaggtcgacgtggtgacgggcgtcggcgcgttcgtcgatccgcatcacatggaagtgcag
acggacggcggcaagaaggtcgtcaagttcaagcaggcgatcatcgctgccggctcgcag
gcgatgaagctgccgttcatgccggaggatccgcgcgtcgtcgattcgacgggcgcgctc
gagctgcgccagttgccgaagcggatgctcgtgatcggcggcggcatcatcggcctcgaa
atggcgaccgtctattcgacgctcggcgccgacatcgacgtcgtcgaaatgatggacggc
ctgatgatgggcgcggaccgcgacctcgtgaaggtctgggagaagtacaacgcgaagcgc
ttcggcaacgtgatgctgaagacgaagacggtcggcgcggaagcgaaggaagacggcatc
tacgtgaagttcgagggcgagaaggcgccggcggaagcgcagcgctacgacctcgtgctc
gtcgcggtgggccgcagcccgaacggcaagaagatcggcgccgacaaggcgggcgtcgcc
gtcaccgatcgcggcttcatcgaagtcgacaagcagatgcgcacgaacgtcccgcacatc
ttcgcgatcggcgatgtcgtcggccagccgatgctcgcgcacaaggcggtgcacgaaggc
cacgtcgcggcggaggcggcgcacggcgagaaggcgtacttcgacgcgctgcagattccg
tcggtcgcgtacaccgatccggaagtcgcgtgggcgggcaagaccgaggatcagtgcaag
gccgaaggcatcaagtacggcaaggccgtgttcccgtgggcggcgtcgggccgcgcgatc
gcgaacggccgcgacgagggcttcacgaagctgctcttcgacgaggagacgcatcgcgtg
atcggcggcggcatcgtcggcctgaacgcgggcgacctcatcagcgaagtgtgtctcgca
gtcgagatgggcgcggacgcggaggacatcggcaagacgatccatccgcacccgacgctc
ggcgaatcgatcggcatggcggccgagttgtacgaaggcgtctgcacggacctgccgccg
cagcgcaagaaatag

DBGET integrated database retrieval system