KEGG   Burkholderia oklahomensis E0147: DM82_2234
Entry
DM82_2234         CDS       T03284                                 

Gene name
trxB
Definition
(GenBank) thioredoxin-disulfide reductase
  KO
K00384  thioredoxin reductase (NADPH) [EC:1.8.1.9]
Organism
bok  Burkholderia oklahomensis E0147
Pathway
bok00450  Selenocompound metabolism
Brite
KEGG Orthology (KO) [BR:bok00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    DM82_2234 (trxB)
Enzymes [BR:bok01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.9  thioredoxin-disulfide reductase
     DM82_2234 (trxB)
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox FAD_binding_2 FAD_oxidored HI0933_like NAD_binding_7 GIDA AlaDh_PNT_C K_oxygenase Thi4 NAD_binding_8 Trp_halogenase
Other DBs
NCBI-ProteinID: AIO67187
LinkDB
Position
1:2570653..2571615
AA seq 320 aa
MSTPKHAKVLILGSGPAGYTAAVYAARANLSPLLITGIAQGGQLMTTTDVENWPADPDGV
QGPELMQRFLAHAERFNTEIVFDHIHTAKLHEKPIRLIGDSGEYTCDALVIATGASAQYL
GLSSEEAFMGRGVSACATCDGFFYRGQNVAVVGGGNTAVEEALYLTGIAKKVTVIHRRDK
FRAEPILVDRLLEKEKEGVVEIKWDHVLDEVTGDDSGVTGVRIKHAKTGATEDVAVQGLF
IAIGHKPNTDIFKGQLEMKDGYIITNSGLSGNATGTSVPGVFAAGDVQDHIYRQAITSAG
TGCMAALDAQRYLESLHDRK
NT seq 963 nt   +upstreamnt  +downstreamnt
atgtccacgcccaaacacgcgaaagtcctgattctcggctccggccccgccggctacacg
gcggccgtctatgcggcccgcgcgaacctgtcgcccctcctgatcacgggcatcgcgcaa
ggcggccaactgatgacgacgaccgacgtcgaaaactggccggccgatccggacggcgtg
cagggcccggagctgatgcagcgcttcctcgcgcacgctgagcgcttcaacaccgaaatc
gtgttcgaccacatccacacggcgaagctgcacgagaagccgatccgcctcatcggcgac
tcgggcgaatacacgtgcgacgcgctcgtcatcgcgacgggcgcgtccgcgcagtatctc
ggcctgtcgtcggaagaagcgttcatgggccgcggcgtatcggcctgcgcgacctgcgac
ggcttcttctaccgcggccagaacgtcgccgtcgtcggcggcggcaacacggccgtcgag
gaagccctctacctgacgggcatcgcgaagaaggtcacggtgatccaccgccgcgacaag
ttccgcgcggagccgatcctcgtcgaccgtctgctcgagaaggagaaggaaggcgtcgtc
gagatcaagtgggaccacgtgctcgacgaagtgacgggcgacgattccggcgtgacgggc
gtgcgcatcaagcacgcgaagacgggcgcgaccgaggacgtcgcggtgcagggcctcttc
atcgcgatcggccacaagccgaacaccgacatcttcaagggccagctcgagatgaaggac
ggctacatcatcacgaacagcggcctgtcgggcaacgcgacgggcacgagcgtgccgggc
gtgttcgcggcgggcgacgtgcaggaccacatctaccgtcaggcgatcacgagcgcgggc
acgggctgcatggcggcgctcgacgcgcagcgctatctcgaaagcctgcacgaccgcaag
taa

DBGET integrated database retrieval system