KEGG   Burkholderia oklahomensis E0147: DM82_269Help
Entry
DM82_269          CDS       T03284                                 

Definition
(GenBank) iron/manganese superoxide dismutase, alpha-hairpin domain protein
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
bok  Burkholderia oklahomensis E0147
Brite
Enzymes [BR:bok01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     DM82_269
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AIO66319
LinkDB All DBs
Position
1:330926..331504
Genome map
AA seq 192 aa AA seqDB search
MAHTLPPLPYAEDALAPHISQETIQYHYGKHHQTYVTNLNNLIPGTEFENLPLEEIVKKS
SGGIFNNAAQIWNHTFFWNSLSPQGGGAPTGALGDAINAKWGSFDAFKEAFTKAAVGTFG
SGWAWLVKKADGSLDIVSTSNAATPLTTADKPLLTIDVWEHAYYIDYRNARPKFVEAFWN
IVNWDFAAKNFA
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atggctcatacgctcccgccgttgccgtacgctgaagacgcgctcgctccgcacatctcg
caggagacgatccagtatcactacggcaagcatcatcagacctatgtgacgaacctgaac
aatctgatccccggcaccgagttcgagaacctgccgctggaagagatcgtgaagaagtcg
tcgggcggcatcttcaacaacgccgcgcaaatctggaatcacacgttcttctggaacagc
ctgtcgccgcagggcggcggcgcgccgacgggcgcgctcggcgacgcgatcaacgcgaag
tggggctcgttcgacgcgttcaaggaagcgttcacgaaggcagcggtcggcaccttcggc
tcgggctgggcgtggctcgtgaagaaggcggacggctcgctcgacatcgtgtcgacgagc
aacgcggcaacgccgctcacgacggccgacaagccgctcctcacgatcgacgtgtgggag
cacgcttactacatcgattaccgcaacgcgcgtccgaagttcgtcgaagcgttctggaac
atcgtgaactgggacttcgccgcgaagaacttcgcgtaa

DBGET integrated database retrieval system