KEGG   Burkholderia oklahomensis E0147: DM82_2819Help
Entry
DM82_2819         CDS       T03284                                 

Definition
(GenBank) hypothetical protein
  KO
K03599  stringent starvation protein A
Organism
bok  Burkholderia oklahomensis E0147
Brite
KEGG Orthology (KO) [BR:bok00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:bok03021]
    DM82_2819
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bok02000]
    DM82_2819
Transcription machinery [BR:bok03021]
 Prokaryotic type
  Bacterial type
   Other transcription-related factors
    RNA polymerase-associated proteins
     DM82_2819
Transporters [BR:bok02000]
 Other Transporters
  Pores ion channels [TC:1]
   DM82_2819
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C GST_C_2 Glutaredoxin GST_C_3
Motif
Other DBs
NCBI-ProteinID: AIO66437
UniProt: A0A381BSL2
LinkDB All DBs
Position
1:complement(3216218..3216829)
Genome map
AA seq 203 aa AA seqDB search
MMVLYSGTTCPFSQRCRLVLFEKGMDFEIRDVDLFNKPEDIAVMNPYGQVPILVERDLIL
YESNIINEYIDERFPHPQLMPADPVQRARARLFLLNFEKELFVHVSTLENEKGKAAEKSH
EKARLAIRDRLTQLAPIFLKNKYMLGEEFSMLDVAIAPLLWRLDHYGIDLSKNAAPLMKY
AERIFSRPAYIEALTPSEKVMRR
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgatggttctgtattccggcacgacttgtccgttctcccagcgttgccggctggtgttg
ttcgaaaagggcatggatttcgagatccgcgacgtcgacctgttcaacaagccggaagac
atcgcggtgatgaatccgtacggacaggtgccgattctcgtcgaacgcgatctgatcctg
tacgaatcgaacatcatcaacgagtacatcgacgagcgcttcccgcatccgcaactgatg
ccggccgacccggtgcagcgcgcgcgcgcgcgcctgttcctgctcaacttcgagaaggaa
ctgttcgtgcacgtgagcacgctcgagaacgagaagggcaaggcggcggagaagagccac
gagaaggcgcgcctcgcgatccgcgatcgcctgacgcagctcgcgccgatcttcctgaag
aacaagtacatgctcggcgaagagttctcgatgctcgacgtcgcgatcgcgccgctgctg
tggcgtctcgaccactacgggatcgatctgtcgaagaacgccgcgccgctgatgaagtat
gcagagcggatcttcagccgtcctgcctatatcgaagcgctgacgccgtccgaaaaggtc
atgcgtcgttaa

DBGET integrated database retrieval system