KEGG   Burkholderia oklahomensis E0147: DM82_286Help
Entry
DM82_286          CDS       T03284                                 

Gene name
icd
Definition
(GenBank) isocitrate dehydrogenase, NADP-dependent
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
bok  Burkholderia oklahomensis E0147
Pathway
bok00020  Citrate cycle (TCA cycle)
bok00480  Glutathione metabolism
bok01100  Metabolic pathways
bok01110  Biosynthesis of secondary metabolites
bok01120  Microbial metabolism in diverse environments
bok01130  Biosynthesis of antibiotics
bok01200  Carbon metabolism
bok01210  2-Oxocarboxylic acid metabolism
bok01230  Biosynthesis of amino acids
Module
bok_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bok_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:bok00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    DM82_286 (icd)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    DM82_286 (icd)
Enzymes [BR:bok01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     DM82_286 (icd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: AIO67643
LinkDB All DBs
Position
1:351833..353092
Genome map
AA seq 419 aa AA seqDB search
MPYQHIKVPEGGDKITVNKDFSLNVSDQPIIPYIEGDGTGFDITPVMIKVVDAAVEKAYA
GKKKIHWMEIYAGEKATKVYGPDVWLPEETLQVLKEYVVSIKGPLTTPVGGGIRSLNVAL
RQDLDLYVCLRPVQYFKGVPSPVRAPEKTDMVIFRENSEDIYAGIEWAAESEQAKKVIKF
LQEEMGVKKIRFPETSGIGIKPVSKEGTERLVRKAIQYAIDNDRKSVTLVHKGNIMKFTE
GAFRDYGYALAQKEFGAELIDGGPWMKFKNPKTGNEIVIKDSIADAFLQQILLRPAEYDV
IATLNLNGDYISDALAAQVGGIGIAPGANLSDSVAMFEATHGTAPKYAGKDYVNPGSEIL
SAEMMLRHLGWTEAADVIIAAMEKSILQKRVTYDFARLMEGATQVSCSGFGQVLIENMQ
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgccgtatcagcacatcaaggttccggaaggcggtgacaagatcaccgtcaacaaggat
ttctcgctcaacgtttccgatcagccgatcattccttacatcgaaggcgacggcacgggc
ttcgacatcacgccggtgatgatcaaggtcgtcgacgcggcggtcgagaaggcgtacgcc
ggcaagaagaagatccactggatggagatctacgccggcgagaaggcgacgaaggtctac
ggtccggacgtatggctgccggaagagacgctgcaggtgctgaaggaatacgtcgtgtcg
atcaaggggccgctcacgaccccggtcggcggcggcatccgctcgctgaacgtcgcgctg
cgccaggatctcgacctgtacgtctgcctgcgccccgtgcagtacttcaagggcgtgccg
tcgccggtgcgcgcgccggaaaagaccgacatggtgatcttccgcgagaattcggaagac
atctacgccggcatcgaatgggcggccgagtccgagcaggcgaagaaggtcatcaagttc
ctgcaggaagagatgggcgtgaagaagatccgcttcccggaaacgtcgggcatcggcatc
aagcccgtgtcgaaggaaggcaccgagcgtctcgtgcgcaaggcgatccagtacgcgatc
gacaacgaccgcaagtcggtcacgctcgtccacaagggcaacatcatgaagttcacggaa
ggcgcgttccgtgactacggctatgcgctcgcgcagaaggagttcggcgccgagctgatc
gacggcggcccgtggatgaagttcaagaacccgaagacgggcaacgagatcgtcatcaag
gattcgatcgccgacgcgttcctgcagcagatcctgctgcgtccggccgagtacgacgtg
atcgcgacgctgaacctgaacggcgactacatctccgacgcgctcgccgcgcaagtcggc
ggcatcggcatcgcgccgggcgcgaacctgtcggattcggtcgcgatgttcgaagcgacg
cacggcacggcgccgaagtacgcgggcaaggattacgtgaacccgggctcggaaatcctg
tcggccgaaatgatgctgcgccacctcggctggaccgaagcggcagacgtcatcatcgcc
gcgatggaaaagtcgatcctgcagaagcgcgtcacgtacgacttcgcgcgcctgatggaa
ggcgcgacgcaagtgtcgtgctcgggcttcggccaggtgctgatcgaaaacatgcagtaa

DBGET integrated database retrieval system